DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPA and Eip74EF

DIOPT Version :9

Sequence 1:NP_001184226.1 Gene:GABPA / 2551 HGNCID:4071 Length:454 Species:Homo sapiens
Sequence 2:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster


Alignment Length:122 Identity:51/122 - (41%)
Similarity:71/122 - (58%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   292 KAAKVQRAPRI--SGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDC---ISWVG-DEGEFKL 350
            :.||..|.|::  ..:.||..|:.|      .||:|||:||.|::.  |   |.|.. ::|.|||
  Fly   763 RKAKKPRKPKLEMGVKRRSREGSTT------YLWEFLLKLLQDREY--CPRFIKWTNREKGVFKL 819

Human   351 NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLI 407
            ...:.|::.||..||||.||||.:.|||||||...::.||.|:|.||:||...|.:|
  Fly   820 VDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDII 876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPANP_001184226.1 GABP-alpha 40..119 CDD:402975
SAM_PNT-GABP-alpha 168..254 CDD:176084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316 6/20 (30%)
ETS 319..403 CDD:197710 41/87 (47%)
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 39/81 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.