DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gabrb1 and GluClalpha

DIOPT Version :9

Sequence 1:NP_037088.1 Gene:Gabrb1 / 25450 RGDID:2649 Length:474 Species:Rattus norvegicus
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:477 Identity:162/477 - (33%)
Similarity:251/477 - (52%) Gaps:57/477 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 AMVCCAHSSNEPSNMSY---VKETVDRLLKG--YDIRLRPD----FGGPPVDVGMRIDVASIDMV 75
            |.:|.|..:|. :.:::   .|:.:|::|..  ||.|:||.    ..||.| |.:.|.|.||..:
  Fly    14 ASLCSASLANN-AKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAV-VRVNIFVRSISKI 76

  Rat    76 SEVNMDYTLTMYFQQSWKDKRLSYSGIP-----LNLTLDNRVADQLWVPDTYFLNDKKSFVHGVT 135
            .:|.|:|::.:.|::.|.|:||.:..|.     |.||..|||    |:||.:|.|:|:...|.:.
  Fly    77 DDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEANRV----WMPDLFFSNEKEGHFHNII 137

  Rat   136 VKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAV 200
            :.|..||:.|:|:|||.:||:.|.||.|:|:.||||.|.|:|.:.|||:||:|:.|.|..|: .|
  Fly   138 MPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGD-PV 201

  Rat   201 TGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSF 265
            ..|..:.||:|::..:.......:..||.|..|.:....||...|:::|.|:|..::.|:|||||
  Fly   202 QVVKNLHLPRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSF 266

  Rat   266 WINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYI 330
            |::..|..|||:||:||:|||.|.::.:..:||.:.|.||||::...|..|||.||||:|.||| 
  Fly   267 WLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNY- 330

  Rat   331 FFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMY 395
                      ||:...:....:|..|.|.:.|         ||..:..:.|::|...|:....|.
  Fly   331 ----------ASRSGSNKANMHKENMKKKRRD---------LEQASLDAASDLLDTDSNATFAMA 376

  Rat   396 SYDSASIQYRKPLSSREGFGRGLDRHGVPGKGRIRRRASQLKVKIPDL---------TDVNSIDK 451
            |..:.....:|||....|....|::       |::........|.|:.         |....||.
  Fly   377 SQFARGGGQQKPLVRHPGDPLALEK-------RLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDV 434

  Rat   452 WSRMFFPITFSLFNVVYWLYYV 473
            .||:.||:.|:|||:|||..|:
  Fly   435 ISRITFPLVFALFNLVYWSTYL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gabrb1NP_037088.1 LIC 9..472 CDD:273305 161/474 (34%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 161/474 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.