DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fosl2 and kay

DIOPT Version :9

Sequence 1:XP_038967734.1 Gene:Fosl2 / 25446 RGDID:2628 Length:331 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:117/275 - (42%) Gaps:78/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   116 GRR-RRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQ 179
            ||| .|...::||||:||.:||||||.|||:||.||.:.|.:|..|.|:||:....::|||..|.
  Fly   404 GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLT 468

  Rat   180 KEKEKLEFMLVAHGPVCK---------------ISPEERRSPPTSGL------------------ 211
            ..|.:||::|..|...|:               |:|....|..:||.                  
  Fly   469 NSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTI 533

  Rat   212 ----QSLRGTGSAVGPVVVK------------QEPPEEDSPSSSAGMDK-----TQRSVIKPISI 255
                .:|..||.:..|:.:|            ::.|.:.:..|.:.:|:     ::|..:.|:|.
  Fly   534 TGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMST 598

  Rat   256 AGGGFYGEEPLHTPIVVTSTPAI-----TPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSS 315
            .       ..:|...::|.|.|.     ||.||    |.|.......|.:.:.|       |.::
  Fly   599 M-------PHVHLSTILTPTGASSGSLQTPITS----TAPGGFGSAFPVTSNGS-------SINN 645

  Rat   316 GDQSSDSLNSPTLLA 330
            .:...:::|||||.|
  Fly   646 INSIGNNMNSPTLNA 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fosl2XP_038967734.1 bZIP_Fos 139..192 CDD:269869 23/52 (44%)
coiled coil 139..183 CDD:269869 19/43 (44%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46432
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.