DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fosl1 and Atf3

DIOPT Version :9

Sequence 1:NP_037085.1 Gene:Fosl1 / 25445 RGDID:2627 Length:275 Species:Rattus norvegicus
Sequence 2:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster


Alignment Length:358 Identity:78/358 - (21%)
Similarity:135/358 - (37%) Gaps:131/358 - (36%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 SSGAGSAYGRPAQPQQAQTQTVQQ--------------QKFHLVPSINAVSGSQELQWMVQPH-- 59
            ||.:||....||  ..|.|.:|||              |....:.:.::.|||:      |||  
  Fly    95 SSCSGSPLDSPA--GTATTPSVQQTCSRLIKEGLKLSIQSKRKLSTCDSSSGSE------QPHSK 151

  Rat    60 -------FLGPSGYPRPLTYPQYSPPQPRPGVI------------RALGPPPGVRRRPCEQISPE 105
                   ..|.||     :...||........:            .....|.|        ::||
  Fly   152 YSRRSSNHNGHSG-----SSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKG--------LTPE 203

  Rat   106 EEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAH 170
            :|:|||.||||||:||.|||.:::|.|..|..|::.|:.:...|:.::.:|:.::::|..:|::|
  Fly   204 DEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH 268

  Rat   171 ----RPICKIPEE--------------------DKKDTGGT----------------SSTSGAGS 195
                ...|::|.:                    |..::|..                |.|:.|.:
  Fly   269 GCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTAAAMA 333

  Rat   196 ---PPGPCRPVPCI---------------------SLSP---GPVLEPEALHTPTLMT--TPSLT 231
               |.|.|:|.|..                     ||:|   ..:.:..|..:|:|::  .|:..
  Fly   334 QQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYVPNCD 398

  Rat   232 PFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSS 264
            ..|.|      ::..|..:.:..:::|||..|:
  Fly   399 GLTGS------ASNHPSHNNNNNNNNSSGASSN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fosl1NP_037085.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..115 11/55 (20%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 109..129 14/19 (74%)
bZIP_Fos 117..170 CDD:269869 16/52 (31%)
coiled coil 117..161 CDD:269869 14/43 (33%)
VirB10_like 128..>247 CDD:421703 31/187 (17%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 135..163 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..275 26/159 (16%)
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/52 (31%)
coiled coil 215..265 CDD:269870 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.