| Sequence 1: | NP_037085.1 | Gene: | Fosl1 / 25445 | RGDID: | 2627 | Length: | 275 | Species: | Rattus norvegicus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001027577.2 | Gene: | kay / 3772082 | FlyBaseID: | FBgn0001297 | Length: | 755 | Species: | Drosophila melanogaster |
| Alignment Length: | 266 | Identity: | 69/266 - (25%) |
|---|---|---|---|
| Similarity: | 100/266 - (37%) | Gaps: | 91/266 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Rat 93 GVRRRP--CEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEE 155
Rat 156 LQKQKERLELVLEAHRPICKIPEED----------------------------------KKDTGG 186
Rat 187 T--------SSTSGAGSP-----------------------------------PGPCRPVPCISL 208
Rat 209 SPGPVLEPEALHTPTLMTTPSL-TPFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLG---- 268
Rat 269 SPTLLA 274 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fosl1 | NP_037085.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..115 | 11/23 (48%) | |||
| Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 109..129 | 14/19 (74%) | |||
| bZIP_Fos | 117..170 | CDD:269869 | 22/52 (42%) | ||
| coiled coil | 117..161 | CDD:269869 | 18/43 (42%) | ||
| VirB10_like | 128..>247 | CDD:421703 | 37/196 (19%) | ||
| Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 135..163 | 9/27 (33%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 171..275 | 32/186 (17%) | |||
| kay | NP_001027577.2 | bZIP_Fos | 420..481 | CDD:269869 | 28/60 (47%) |
| coiled coil | 421..480 | CDD:269869 | 28/58 (48%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1414 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0002314 | |
| OrthoInspector | 1 | 1.000 | - | - | otm46432 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23351 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 6 | 5.960 | |||||