DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sid1 and par-1

DIOPT Version :9

Sequence 1:NP_593564.1 Gene:sid1 / 2542746 PomBaseID:SPAC9G1.09 Length:471 Species:Schizosaccharomyces pombe
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:357 Identity:93/357 - (26%)
Similarity:161/357 - (45%) Gaps:78/357 - (21%)


- Green bases have known domain annotations that are detailed below.


pombe     9 YTLLRKLGSGSFGVVWKARENVSGDIIAIKQID---LETGIDDITDIEQEVFMLSNCNSSNVIQY 70
            |.|::.:|.|:|..|..|:...:|..:|||.||   |..|  .:..:.:||.::...:..|:::.
  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPG--SLQKLFREVRIMKMLDHPNIVKL 315

pombe    71 YGCFVDGYTLWILMEHMDGGSVSGLLKM-GRLNEQVISIILREVLYGLNYLHGQNKIHRDIKAAN 134
            :.......||:::||:..||.|...|.: ||:.|:...:..|:::..:.|.|.:..||||:||.|
  Fly   316 FQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAEN 380

pombe   135 ILLSSSTGNVKLADFGVAAQLSNAASRRHTFVGTPFWMAPEVIQQTSY-GLAADIWSLGITAIEM 198
            :||.|.. |:|:||||.:.:.: ..|:..||.|:|.:.|||:.|...| |...|:||||:....:
  Fly   381 LLLDSEL-NIKIADFGFSNEFT-PGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTL 443

pombe   199 ANGIPP--RATMHPM--RVI---FEIPQSEPPKLDDHFSPTFRDFVSCCLDLNPNMRWSAKELLQ 256
            .:|..|  .:|:..:  ||:   :.||        .:.|....:.:...|.|||..|.|.:.::.
  Fly   444 VSGSLPFDGSTLRELRERVLRGKYRIP--------FYMSTDCENLLRKFLVLNPAKRASLETIMG 500

pombe   257 HPFIKSAGTVKDIIPLLVQKENKLFDDSDQSVLEETINNTLKPFEEPIAEGNADIEDWTFETVKK 321
            ..::                 |..|::.:           |||:.||    .||:.|        
  Fly   501 DKWM-----------------NMGFEEDE-----------LKPYIEP----KADLAD-------- 525

pombe   322 SDSTVLGNTSIPKN---SIISSQNKEELPSSI 350
                       ||.   .:....|:.|:.:|:
  Fly   526 -----------PKRIEALVAMGYNRSEIEASL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sid1NP_593564.1 STKc_MST3_like 7..279 CDD:270786 78/281 (28%)
S_TKc 9..260 CDD:214567 78/262 (30%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 78/262 (30%)
S_TKc 253..504 CDD:214567 78/262 (30%)
UBA_MARK_Par1 525..563 CDD:270522 6/41 (15%)
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.