DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNIH2 and cni

DIOPT Version :10

Sequence 1:NP_872359.1 Gene:CNIH2 / 254263 HGNCID:28744 Length:160 Species:Homo sapiens
Sequence 2:NP_477068.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster


Alignment Length:159 Identity:76/159 - (47%)
Similarity:100/159 - (62%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLR 65
            |||.|.||.|::.|:..|.||||.|:|:||||||:||:||||||                |..|.
  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQ----------------CNSLN 49

Human    66 KLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNY 130
            .||:|||.:|....|:||...||.:|.:||||:.||:|||.:||......:||..:::..|.|..
  Fly    50 PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114

Human   131 CQKESWCKLAFYLLSFFYYLYSMVYTLVS 159
            ..:|.|.|||.||:|||||:|.|||:|:|
  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNIH2NP_872359.1 Cornichon 7..151 CDD:460883 66/143 (46%)
cniNP_477068.1 Cornichon 7..135 CDD:460883 66/143 (46%)

Return to query results.
Submit another query.