DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsh and CG5367

DIOPT Version :9

Sequence 1:NP_037071.1 Gene:Ctsh / 25425 RGDID:2447 Length:333 Species:Rattus norvegicus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:328 Identity:110/328 - (33%)
Similarity:171/328 - (52%) Gaps:24/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    15 LSAGATAELTVNA-IEKFHFTSWMKQHQKTYSS-REYSHRLQVFANNWRKIQAHNQR----NHTF 73
            ||.|.::.....: .|||...: .:::.:||.. |.|    :.|..|::.|:.|||.    ..:|
  Fly    22 LSEGNSSSANCKSEFEKFKNNN-NRKYLRTYDEMRSY----KAFEENFKVIEEHNQNYKEGQTSF 81

  Rat    74 KMGLNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGP-----YPSSMDWRKKGNVVSPVKNQ 133
            ::..|.|:|||.......:|.....|...:..|.....|.     .|.|:|||.|| .::|..||
  Fly    82 RLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKG-FITPPYNQ 145

  Rat   134 GACGSCWTFSTTGALESAVAIASGKMMTLAEQQLVDCAQNFNNHGCQGGLPSQAFEYILYNKGIM 198
            .:||||:.||...::...|...:||:::|::||:|||:.:..|.||.||.......|:....|||
  Fly   146 LSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIM 210

  Rat   199 GEDSYPYIGKNGQCKFNPEKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVT-EDFMMYKS 262
            .:..|||:.:.|:|:|.|:.:|..|.:...:.:.||.|:..||....||:.:...: :.|.:|..
  Fly   211 RDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSD 275

  Rat   263 GVYSSNSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSNWGNNGYFLIERGKNMCGLAACAS 327
            |:|....|...  .||||::.:|:|:.    |||:||.||.|||.|||..|.:|.||||:|..|:
  Fly   276 GIYDDPLCSSA--SVNHAMVVIGFGKD----YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAA 334

  Rat   328 YPI 330
            |.|
  Fly   335 YAI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtshNP_037071.1 Inhibitor_I29 33..88 CDD:400519 16/59 (27%)
Peptidase_C1 115..330 CDD:395062 83/215 (39%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 19/64 (30%)
Peptidase_C1A 128..336 CDD:239068 82/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.