DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment apm4 and stnB

DIOPT Version :9

Sequence 1:NP_592921.1 Gene:apm4 / 2541527 PomBaseID:SPAC31A2.09c Length:446 Species:Schizosaccharomyces pombe
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:450 Identity:94/450 - (20%)
Similarity:146/450 - (32%) Gaps:146/450 - (32%)


- Green bases have known domain annotations that are detailed below.


pombe   102 DNVSFIFELLDEMIDYGIIQTTEPDALARSVSIT----------------AVKKKGN---ALSLK 147
            |....||.:..:.|.|.......|..:.::..||                .||:.|:   .|.|.
  Fly   795 DQFGKIFTMKLQYIFYKERPGVRPGQVTKAERITNKLTKFAQYAIAGDYEGVKEFGSDLKKLGLP 859

pombe   148 RSH---SSQLAHTTS-------------SEIPGSVP-WRRAGIKYRKNSIYIDIVERMNLLISST 195
            ..|   ||||....|             .|....:| .|...:.|:...:.:..|:.:.:.....
  Fly   860 VEHAPQSSQLFKIGSMNYEDMKQFSVCIEEALFKIPALRERALTYKMEEVQVTAVDEITVEQDFE 924

pombe   196 GNVLRSDVSGVVKMR----AMLSGMPECQFGLNDKLDFKLKQSESKSKSNNSRNPSSVNG----- 251
            |.:|:.    :.::|    |.|:|||..:.|:||..                |....|.|     
  Fly   925 GKILKQ----IARVRLFFLAFLTGMPTIELGVNDMW----------------RQGKEVVGRHDII 969

pombe   252 -----GFVILEDCQFHQCVRLPEFENEHRITFIPPDGE-VELMSYRSHENINIPFRIVPIVEQLS 310
                 .::.||..:||..|...|:|....|.|.|||.. :||:.:|.....|   |.:|:  ||.
  Fly   970 PVATEEWIRLEAVEFHSVVNQKEYERTRTIKFQPPDANYIELLRFRVRPPKN---RELPL--QLK 1029

pombe   311 KQKII--YRISIRADY------PHKLS----SSLNFRIPVP------------------------ 339
            ....:  .::.:|||.      ..||.    ..::.|.|:|                        
  Fly  1030 ATWCVSGNKVELRADILVPGFTSRKLGQIPCEDVSVRFPIPECWIYLFRVEKHFRYGSVKSAHRR 1094

pombe   340 TNVVKANPR--------------VNRGKAGYEPSENIINWKIPRFLGETELIFYAEVELSNTTNQ 390
            |..:|...|              |..|:|.||.....|.|:.||...|.:..:        ||:|
  Fly  1095 TGKIKGIERILGAVDTLQESLIEVTSGQAKYEHHHRAIVWRCPRLPKEGQGAY--------TTHQ 1151

pombe   391 QIWAKPPISLD--------FNILMFTSSGLHVQYLRVS----EPSNSKYKSIKWVRYSTR 438
            .:......|.|        :..:.||.....|.:..|.    :.|:......|:|||..|
  Fly  1152 LVCRMALTSYDQIPSELAPYAFVEFTMPATQVSHTTVRSVSVQDSDGDEPPEKYVRYLAR 1211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apm4NP_592921.1 Clat_adaptor_s 1..134 CDD:261170 6/31 (19%)
AP-2_Mu2_Cterm 175..445 CDD:271159 71/340 (21%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 72/347 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.