DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vac8 and p120ctn

DIOPT Version :9

Sequence 1:NP_595238.1 Gene:vac8 / 2541010 PomBaseID:SPBC354.14c Length:550 Species:Schizosaccharomyces pombe
Sequence 2:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster


Alignment Length:482 Identity:104/482 - (21%)
Similarity:178/482 - (36%) Gaps:147/482 - (30%)


- Green bases have known domain annotations that are detailed below.


pombe    71 FAEITEKDVREVDR---ETIEPVLFLLQSPDAEIQRAASVALGNLA-VNAENKALVVKLNGLDLL 131
            :.|.:|.|:....|   ..:..|:..|.:|.:.|:..|:..|.:|. ::..||.....|.|:..|
  Fly   208 YIEGSENDICSTMRWRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPL 272

pombe   132 IRQMMSPHVEVQCNAVGCITNLA---TLDENKSKIAHSGALGPLTR-LAKSKDIRVQRNATGALL 192
            :|.:.....|:..||.|.:.||:   ..||||..|.::|.:..|.. |.:|::..|:...||.|.
  Fly   273 VRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVLW 337

pombe   193 NMTHSYENRQQLVSAGTIPVLVSLL-PSSDTDVQYYCTTSIS-----------NIAVDAVHRKRL 245
            ||:...:.::.::....:.|:.|:: |.|..|......|..|           |::....|.:..
  Fly   338 NMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGETCFSTVFRNASGVLRNVSSAGEHARGC 402

pombe   246 AQSEPKLVRSLIQLMDTSSPK-------------------VQCQA-------------------- 271
            .::...||..|:.::.||..|                   .:||.                    
  Fly   403 LRNCEHLVECLLYVVRTSIEKNNIGNKTVENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPS 467

pombe   272 -----------------------ALALRNLASD----------------ERYQIEIVQSNALPSL 297
                                   ||...|:::|                :.:|.|:||     ..
  Fly   468 SSKGENLGCFGTNKKKKEANNSDALNEYNISADYSKSSVTYNKLNKGYEQLWQPEVVQ-----YY 527

pombe   298 LRLLRSSYLPLIL-ASVACIRNISIHPLNESPIIDAGFLRPLVDLLSCTENEE------------ 349
            |.||:|...|..| |:...|:|:|           |.:.:|.:|:.:....|:            
  Fly   528 LSLLQSCSNPETLEAAAGAIQNLS-----------ACYWQPSIDIRATVRKEKGLPILVELLRME 581

pombe   350 ---IQCHAVSTLRNLAASSERNKRAIIEANAIQKLRCLILDAPV-SVQSE-------MTACLA-- 401
               :.|...:.|||||. .:|||..|    ....:|.|:...|. :||.:       :||.||  
  Fly   582 VDRVVCAVATALRNLAI-DQRNKELI----GKYAMRDLVQKLPSGNVQHDQNTSDDTITAVLATI 641

pombe   402 --VLALSDEFKSYLLNFGICNVLIPLT 426
              |:..:.||...||:.|..:.|:.:|
  Fly   642 NEVIKKNPEFSRSLLDSGGIDRLMNIT 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vac8NP_595238.1 HEAT repeat 17..37 CDD:293787
HEAT repeat 48..76 CDD:293787 1/4 (25%)
ARM 82..195 CDD:237987 34/120 (28%)
armadillo repeat 119..155 CDD:293788 11/38 (29%)
armadillo repeat 160..194 CDD:293788 10/34 (29%)
ARM 162..280 CDD:237987 31/192 (16%)
armadillo repeat 201..235 CDD:293788 7/45 (16%)
armadillo repeat 244..278 CDD:293788 10/95 (11%)
armadillo repeat 286..361 CDD:293788 20/90 (22%)
ARM 307..404 CDD:237987 30/124 (24%)
armadillo repeat 369..405 CDD:293788 12/47 (26%)
Arm 406..446 CDD:278915 7/21 (33%)
armadillo repeat 410..444 CDD:293788 5/17 (29%)
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 34/113 (30%)
armadillo repeat 227..252 CDD:293788 6/24 (25%)
armadillo repeat 260..296 CDD:293788 11/35 (31%)
armadillo repeat 304..339 CDD:293788 10/34 (29%)
ARM 307..442 CDD:237987 26/134 (19%)
armadillo repeat 347..392 CDD:293788 7/44 (16%)
armadillo repeat 515..556 CDD:293788 15/56 (27%)
ARM 516..643 CDD:237987 37/147 (25%)
armadillo repeat 562..596 CDD:293788 4/33 (12%)
armadillo repeat 601..641 CDD:293788 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.