DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cebpe and Irbp18

DIOPT Version :9

Sequence 1:NP_058791.1 Gene:Cebpe / 25410 RGDID:2329 Length:281 Species:Rattus norvegicus
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:79 Identity:21/79 - (26%)
Similarity:45/79 - (56%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat   188 SPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERLRSRVDQ 252
            ||..|        :.|...|:.:|::||.||:::|:|.|:...|.::::.:...:|:.|:.:::.
  Fly    17 SPLSP--------HTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIET 73

  Rat   253 LTQELDTLRNLFRQ 266
            ..:.:.|||:|..|
  Fly    74 SEKHISTLRDLIIQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CebpeNP_058791.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
bZIP_CEBPE 202..262 CDD:269863 15/59 (25%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 10/36 (28%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 6/21 (29%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 15/58 (26%)
coiled coil 25..83 CDD:269841 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45835
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.