DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sce3 and eIF4B

DIOPT Version :9

Sequence 1:NP_595728.1 Gene:sce3 / 2540528 PomBaseID:SPBC18H10.04c Length:388 Species:Schizosaccharomyces pombe
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:167/421 - (39%) Gaps:113/421 - (26%)


- Green bases have known domain annotations that are detailed below.


pombe     5 KSTKMSLNAFL--GDESFGSTNWADDIDDLPALPQDRTTSTYRATPSSADAGYNAPSSTFESVRS 67
            |.|.:||.:||  .|...|:|..:..|.:|.....|..:.|....       |..|::       
  Fly    12 KGTVISLQSFLCNSDAPVGTTQVSKKIRNLDGDDSDDGSGTLPLV-------YQLPTA------- 62

pombe    68 PPESRREGGMGSGYQRDAIPIPSEPPFTAHVGNLSFDLTENDLGDFFGEGVTSIRLVI---DPLT 129
             |.:.|        ..|...||.:.||.|::.||.||..|:||.:|| ||:..|.|.:   |...
  Fly    63 -PRANR--------IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFF-EGINLISLRLPREDGEN 117

pombe   130 ERSRGFGYVEFETADTLSAALALSGEDLMGRPVRITVAEPRRSFAREE--------------RST 180
            .|||||||||.|..:.|...|:|....:.||.:||.::......:|::              |.:
  Fly   118 GRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDS 182

pombe   181 GDWVR----------------------RGPLPPAEPAESPFGKRRTNSGRFRDPARDPSDRVREE 223
            |:|.|                      |..||..:...:| |..|| |.|.:.....|:.|..|:
  Fly   183 GNWRRDSQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP-GSWRT-SARPQSIDTSPTRREVEQ 245

pombe   224 PREWVRRGPLP-----PRESS-----ERPRLNLKPRSSSNVNTEATPSATTTTSSKPKRDP---- 274
            ..|..|.|.:.     .||.:     |||:||||||      |...|...|....|...|.    
  Fly   246 VSEKYREGRVKIADRYSREETSKVEEERPKLNLKPR------TLPLPDVKTIEFEKCDVDEFNLD 304

pombe   275 ----------FGGAKPVDNTSVLQRVEEKLAKRTQSFRREDNANRERSTSRKPSADKAEKTDKTD 329
                      ||.|||||..:....:|::||..    |::|...||:..:.|.:..:.:|.| .:
  Fly   305 KQGGTSSLNVFGSAKPVDTAARELEIEQRLALA----RKQDKGRREQGLNEKLAELQVDKND-NE 364

pombe   330 AIAEKVS-----DIRLGD------GEKKSSE 349
            :::..||     |.:..|      |||:..|
  Fly   365 SLSATVSWRTNQDYKESDKINKCPGEKQRDE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sce3NP_595728.1 RRM 1..255 CDD:223796 85/300 (28%)
RRM_SF 95..169 CDD:302621 32/76 (42%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 58/198 (29%)
RRM_eIF4B 79..155 CDD:240848 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3394
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102008
orthoMCL 1 0.900 - - OOG6_105219
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.