DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccng1 and CycB3

DIOPT Version :9

Sequence 1:NP_037055.1 Gene:Ccng1 / 25405 RGDID:2295 Length:294 Species:Rattus norvegicus
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:250 Identity:55/250 - (22%)
Similarity:107/250 - (42%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    44 LRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSI 108
            :.:|..:|...|..::.:.:.|..:.||..|||.::|.:|.:..:..:.|..:|.:.|::|.|  
  Fly   330 IHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACK-- 392

  Rat   109 EEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIRETLPFERR 173
            .:||..||..|.:.|....:...:|:|||:..|..:.:.:....:::||:.|....:..:|    
  Fly   393 YDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMP---- 453

  Rat   174 NDLNFERLEAQLKAC-HCRIIFSKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKIS---- 233
             .|...|...:|... :..|.||.::.:..|| .:||.:..        |...:.|.:..|    
  Fly   454 -TLTLARYILELSLMDYANISFSDSQMASAAL-FMALRMHG--------GPGQLDKQTWTSTLIY 508

  Rat   234 --GRDLTFWQELVSKCLTEYSSNKCSKPNGQKLKWIVSGRTARQLKHSY-YRITH 285
              |..|..:.|:|    |..::....||..          |.:.:::.| ::|.|
  Fly   509 YTGYQLADFAEIV----TALNAGLHRKPRA----------TIKTIRNKYSHKIFH 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccng1NP_037055.1 CYCLIN_CCNG1 50..147 CDD:410286 26/96 (27%)
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/104 (26%)
Cyclin_C 435..555 CDD:281044 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.