DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atf21 and kay

DIOPT Version :9

Sequence 1:NP_595707.1 Gene:atf21 / 2540363 PomBaseID:SPBC2F12.09c Length:355 Species:Schizosaccharomyces pombe
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:341 Identity:82/341 - (24%)
Similarity:128/341 - (37%) Gaps:114/341 - (33%)


- Green bases have known domain annotations that are detailed below.


pombe    71 TSFPSNSHNNYA-SIVGDAS-IGHYLKGPERTSEVSLPQTVNLSEISNNNDKGQ-------PTNT 126
            ||..:.|.||:: :...||| |..:|     .:|:.|.|.       .|.:.||       ||.|
  Fly   201 TSAAAGSDNNHSDNFAMDASEIATFL-----ANELFLQQL-------GNFETGQSVLTLTTPTLT 253

pombe   127 PPVRSTIVAPSLYSEGSTLNHYNNGSH--------------------QVLHPQFQNGTNAPYVVQ 171
            |.....|        ..||.|..:.:.                    .||      |...|..|.
  Fly   254 PTTTRNI--------EDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVL------GMGIPTGVS 304

pombe   172 SNLMQNNVNLT---GAEQEKGLDLYK-----------NSATANNDEIFYNLESLRREGYLNSNKK 222
            |..:|...:|:   |:|.|.....|.           ::::|:.|...|      :.|::     
  Fly   305 SLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSY------QAGHI----- 358

pombe   223 QSQSPNGDYNSSDESCSNKTVASSQRRGTP--GSNNVHTA--------------SNNETPDMKRR 271
            .:.|.||   ....:.||...|.|..||:.  ||:|.:|:              |.|.||:.:::
  Fly   359 MAGSVNG---GGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQK 420

pombe   272 RFL--ERNRIAASKCRQKKKLWTQNLEKTAHIACEQSKALRILVSQLREEVICL---KNQ---LL 328
            |.:  |||:.||::||:::...|..|       .|:.:.|......:|:|:..|   |||   ||
  Fly   421 RAVRRERNKQAAARCRKRRVDQTNEL-------TEEVEQLEKRGESMRKEIEVLTNSKNQLEYLL 478

pombe   329 AHQDCNCEGIRQYLSS 344
            |.....|:.||..:.|
  Fly   479 ATHRATCQKIRSDMLS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atf21NP_595707.1 bZIP_ATF2 269..329 CDD:269835 19/67 (28%)
coiled coil 269..329 CDD:269835 19/67 (28%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/67 (31%)
coiled coil 421..480 CDD:269869 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.