DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPBC2G5.02c and Ste:CG33243

DIOPT Version :9

Sequence 1:NP_596063.1 Gene:SPBC2G5.02c / 2540306 PomBaseID:SPBC2G5.02c Length:254 Species:Schizosaccharomyces pombe
Sequence 2:NP_996425.2 Gene:Ste:CG33243 / 2768897 FlyBaseID:FBgn0053243 Length:172 Species:Drosophila melanogaster


Alignment Length:180 Identity:66/180 - (36%)
Similarity:92/180 - (51%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


pombe    32 SSPLHENVSWISWFCSRPGREYFVEVKEDFIEDLFNLTGLNLAVPFYNEALDLILDRTAPDTLEN 96
            ||..:.|.|||.||....|.::...|..|:::|.||..||.    :::|.||:||          
  Fly     2 SSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVIL---------- 52

pombe    97 FDMDVIETSAQIL-------YGLIHQRYIITRTGLHQMAEKYSMGIFGCCPRVNCCYTHVLPAGL 154
              ..||::|:.:|       ||:||.|||.:..||..|..||..|.||.||.::|...:.||.||
  Fly    53 --KPVIDSSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGL 115

pombe   155 SDIVGKMPVMLFCPNCLDLYAPSSSRYKNIDGSFFGATFPHLFFESYPEL 204
            |.:.||..|.:.||.|...:.|.|.  ..:||:.||.:||.:||...|.|
  Fly   116 SAVWGKSTVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPNL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPBC2G5.02cNP_596063.1 SKB2 14..242 CDD:227374 66/180 (37%)
Ste:CG33243NP_996425.2 CK_II_beta 11..166 CDD:198153 62/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.