DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and par-1

DIOPT Version :9

Sequence 1:NP_596657.1 Gene:ppk25 / 2540267 PomBaseID:SPBC32C12.03c Length:423 Species:Schizosaccharomyces pombe
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:290 Identity:110/290 - (37%)
Similarity:168/290 - (57%) Gaps:11/290 - (3%)


- Green bases have known domain annotations that are detailed below.


pombe    17 SIPKRSQNIKINQSTKHQRSISDFVGTAGPGRQVGNWIIKKTIGAGSMGKVKLVVNILTGEKAAL 81
            |..|.|.|:::..|...:...::        ..:|.:.:.||||.|:..||||..::.||::.|:
  Fly   225 SSAKGSPNMQMRSSAPMRWRATE--------EHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAI 281

pombe    82 KMIPFTPNNTSQTVRVQREALLGRLLRHPNICRVIDCIRTPACTYILFEYVPGGQLLEYILARGK 146
            |:|..|..|.....::.||..:.::|.||||.::...|.|....|::.||..||::.:|::..|:
  Fly   282 KIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGR 346

pombe   147 LDEDLARSFAMQLINALVYLHKNFIVHRDLKIENVLLTQDSR-QVKLIDFGLSNFYSKDDLLRTY 210
            :.|..||....|:::|:.|.|:..|:|||||.||:||  ||. .:|:.|||.||.::....|.|:
  Fly   347 MKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLL--DSELNIKIADFGFSNEFTPGSKLDTF 409

pombe   211 CGSLYFAAPELLDAKPYIGPEVDVWSLGVVIYVMVCGRVPFDDVSVPMLHSKIKSGKLEFPSYIS 275
            |||..:|||||...|.|.|||||||||||::|.:|.|.:|||..::..|..::..||...|.|:|
  Fly   410 CGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMS 474

pombe   276 EDCCSLIAAMLNVNPRKRCSLEQAAKFPWL 305
            .||.:|:...|.:||.||.|||......|:
  Fly   475 TDCENLLRKFLVLNPAKRASLETIMGDKWM 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_596657.1 STKc_Kin1_2 51..305 CDD:270979 104/254 (41%)
S_TKc 53..305 CDD:214567 103/252 (41%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 103/253 (41%)
S_TKc 253..504 CDD:214567 103/252 (41%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5061
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.