DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPBC530.15c and CG33282

DIOPT Version :9

Sequence 1:NP_595328.2 Gene:SPBC530.15c / 2540262 PomBaseID:SPBC530.15c Length:516 Species:Schizosaccharomyces pombe
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:473 Identity:98/473 - (20%)
Similarity:163/473 - (34%) Gaps:156/473 - (32%)


- Green bases have known domain annotations that are detailed below.


pombe    36 LEESLKKYPVISNPQDFIVTLDGPDDPDLAVNWPLAKKLRNVAVMGSACLCAGFGSSIFSGAVPE 100
            |..:|.|.....:|.||.|.|       ..::| |.      :::|...||...           
  Fly    38 LSPTLTKIQTADSPLDFEVNL-------AQISW-LG------SMLGLDSLCGNL----------- 77

pombe   101 VMVKFHVCRTVALL------GISLYVLGFASGP--VVWAPMCELFGRRRPMIIAVFIFCIFHIAV 157
                     |:|:|      ...||::   :||  .:|                :.|:|      
  Fly    78 ---------TIAMLIERAGRKFCLYLM---AGPYACIW----------------ILIYC------ 108

pombe   158 ATAKDIQTVMICRFFCGFFGSSPITTVAGSFSDMFSARTRGLVIAVYSAIIFNGPLMSPIVGGFI 222
              |.::..:...||.|||.|.:....|....|::..:..||   |:.|.::.:..|  .|:.|:|
  Fly   109 --ASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRG---ALTSMVMLSVDL--GILAGYI 166

pombe   223 GKSYLGWRWTSYITAIMGFTAFTSMII----------------------FHR--------ETYTR 257
            ..:||.:....::..|:....|.:.|:                      ::|        :|...
  Fly   167 LSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKV 231

pombe   258 TITEIRAS------------KVRVLTGNYCLHAKSEEEPLEFSYFFHKYFTFPLRLL--IFEPIL 308
            ...|:|.:            ..:.||....|...:....|...|.|...|:| :..:  ||:...
  Fly   232 NFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSF-INYMSDIFKASG 295

pombe   309 LVVSTYTAFVYGILYGLLEAYPVIFGESRKWRLGVESLPYLAIFV-----------GVCIGCSSV 362
            .||...||   .|:.||::.            :||.:...|...|           ||.|||.:.
  Fly   296 SVVDVNTA---TIIIGLVQI------------VGVYTSTILVDIVGRRVLMLISTMGVGIGCIAF 345

pombe   363 ALFQPYYFKKMDENKGRPVPEARLPSMMIGCIVFP---IGIFWLAWTGNYP-WIHWIVPTLAGSF 423
            ..| .|..|..|.:....:|   |..|:|.|.|..   ||||:|.....:| .|..:..:|:..|
  Fly   346 GCF-TYLAKIYDLSDFNWLP---LVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSVIF 406

pombe   424 IG---FGIITIFQQTINY 438
            :.   ||.:.:|...::|
  Fly   407 LSLLVFGTLKLFPLMLHY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPBC530.15cNP_595328.2 MFS 77..502 CDD:119392 88/432 (20%)
MFS_1 85..466 CDD:284993 87/424 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 98/473 (21%)
MFS_1 53..409 CDD:284993 90/441 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.