DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tif512 and eEF5

DIOPT Version :9

Sequence 1:NP_596130.2 Gene:tif512 / 2540232 PomBaseID:SPBC336.10c Length:169 Species:Schizosaccharomyces pombe
Sequence 2:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster


Alignment Length:153 Identity:92/153 - (60%)
Similarity:120/153 - (78%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


pombe    13 MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDI 77
            |||.:. .||..::|||.|:|||||||||||.|::|.||||||:|||||||||||||||:|.:||
  Fly     1 MAELDD-QFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDI 64

pombe    78 FNGRKYEDMSPSTHNMDVPVVKRDEYQLVNI-DDGYLNLMTTDGTTKDDVRLPEGELGNEIEEGF 141
            |:.:||||:.|||||||||.|||::.||:.| ||.:|.|||..|..::|:::||||||.::...|
  Fly    65 FSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDF 129

pombe   142 EEGKDLIITVVSAMGEEIALACR 164
            :.||||:.||:.|.|||..:|.:
  Fly   130 DSGKDLLCTVLKACGEECVIAIK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tif512NP_596130.2 PLN03107 13..167 CDD:215580 92/153 (60%)
S1_eIF5A 98..166 CDD:239914 32/68 (47%)
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 92/151 (61%)
eIF-5a 84..152 CDD:279611 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1358
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100947
Inparanoid 1 1.050 192 1.000 Inparanoid score I1044
OMA 1 1.010 - - QHG53968
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm47366
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.