DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp3 and Strica

DIOPT Version :9

Sequence 1:NP_037054.1 Gene:Casp3 / 25402 RGDID:2275 Length:277 Species:Rattus norvegicus
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:245 Identity:72/245 - (29%)
Similarity:103/245 - (42%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    49 IINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSS 113
            |.|::.|....  ..|.|:..|...||.||..||.:|....|.|...|.:.:..:..:|...:|:
  Fly   317 IFNHERFDNKN--EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379

  Rat   114 FVCVILSHG---------------DEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQAC 163
            .|.||||||               |:.|:|    |: |:.          |:|..||||..:|||
  Fly   380 LVLVILSHGTRHDQIAAKDDDYSLDDDVVF----PI-LRN----------RTLKDKPKLIFVQAC 429

  Rat   164 RGTELDC---GIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKL 225
            :|   ||   |..||       |.|......:.|..|||..|:.|:| :.||:.|||:||..|..
  Fly   430 KG---DCQLGGFMTD-------AAQPNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNR 483

  Rat   226 YAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYF 275
            .....:...|:..|.:.|..:.:.          :|||.:.|.||.:..|
  Fly   484 SGKTSDIDTIMMNVRQVVKMQSKD----------RQIPSVTSTLTSKYVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp3NP_037054.1 CASc 37..277 CDD:214521 72/245 (29%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.