DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alx1 and Rx

DIOPT Version :9

Sequence 1:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus
Sequence 2:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster


Alignment Length:446 Identity:109/446 - (24%)
Similarity:158/446 - (35%) Gaps:180/446 - (40%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 EHVMETLDNESFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELN 93
            :|......|.:..|.:.:|            :|..||:..|   ||.||......|      :||
  Fly   487 QHDFRNSGNGNPNGNSNSG------------DHGERLNADS---DSLVNGSCASSE------DLN 530

  Rat    94 RAMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPD 158
            :.        .|..:|....|..|:.|.  |.|.:..|.||:|||||:.||.|||:.|:|:||||
  Fly   531 QT--------NSSEQGEKITSGSDDEGQ--DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPD 585

  Rat   159 VYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYD--------------- 208
            ||.||:||::..|.|.||||||||||||||::|:...::...:||.....               
  Fly   586 VYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWL 650

  Rat   209 ----ISVLPRTDSYPQI--------QNNLWAGNTSGGSVVT------------------------ 237
                :|.||...|:||.        ..:|..||.:..|:..                        
  Fly   651 SPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQ 715

  Rat   238 -----------------------------SCMLPRDASSCMTPYS---------HS---PRTDSS 261
                                         |.|.|. |:|..:|:.         ||   |.:.::
  Fly   716 PPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPH-ATSLGSPHHGVTPLGTPLHSSLPPSSTAT 779

  Rat   262 YTGFSNHQN---------------------QFGHVPLNNFFTD---SLLTGTTN---GHAFE--- 296
            ....|:.|:                     ..|:...|....|   .|..|:|:   |.:.:   
  Fly   780 TVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPGSSLDKCA 844

  Rat   297 --------------------------TKPEFERRSSSIAVLRMKAKEHTANISWAM 326
                                      :.|..:.||:|||.||:|||||..|::..|
  Fly   845 ASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEHLDNLNKGM 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 36/52 (69%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 44/281 (16%)
OAR 302..319 CDD:281777 11/16 (69%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 9/12 (75%)
RxNP_726006.3 Homeobox 563..615 CDD:278475 36/51 (71%)
OAR 876..892 CDD:281777 10/15 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.