Sequence 1: | NP_037053.1 | Gene: | Alx1 / 25401 | RGDID: | 2273 | Length: | 326 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
Alignment Length: | 446 | Identity: | 109/446 - (24%) |
---|---|---|---|
Similarity: | 158/446 - (35%) | Gaps: | 180/446 - (40%) |
- Green bases have known domain annotations that are detailed below.
Rat 29 EHVMETLDNESFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELN 93
Rat 94 RAMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPD 158
Rat 159 VYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYD--------------- 208
Rat 209 ----ISVLPRTDSYPQI--------QNNLWAGNTSGGSVVT------------------------ 237
Rat 238 -----------------------------SCMLPRDASSCMTPYS---------HS---PRTDSS 261
Rat 262 YTGFSNHQN---------------------QFGHVPLNNFFTD---SLLTGTTN---GHAFE--- 296
Rat 297 --------------------------TKPEFERRSSSIAVLRMKAKEHTANISWAM 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Alx1 | NP_037053.1 | Homeobox | 135..188 | CDD:278475 | 36/52 (69%) |
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 | 192..326 | 44/281 (16%) | |||
OAR | 302..319 | CDD:281777 | 11/16 (69%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 306..319 | 9/12 (75%) | |||
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 36/51 (71%) |
OAR | 876..892 | CDD:281777 | 10/15 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |