DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alx1 and al

DIOPT Version :9

Sequence 1:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:376 Identity:96/376 - (25%)
Similarity:123/376 - (32%) Gaps:196/376 - (52%)


- Green bases have known domain annotations that are detailed below.


  Rat    95 AMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDV 159
            |..|.|    |||.......|.||...|       .|:||:||||||.|||||||.|.:||||||
  Fly    59 ASGGTN----SPVSDGNSDCEADEYAPK-------RKQRRYRTTFTSFQLEELEKAFSRTHYPDV 112

  Rat   160 YVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNN 224
            :.||:||::..|||||:|||||||||||||:|:.|                  |::..|    |.
  Fly   113 FTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG------------------PQSHPY----NP 155

  Rat   225 LWAGNTSGGSVVTSCMLPRDASSCMTPYSH---------------------------SPRTDSSY 262
            ...|..:....|....||.:      |::|                           :|...|.|
  Fly   156 YLPGGAATMQTVVGAALPPN------PFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGY 214

  Rat   263 TGFSNHQNQFGHV----------PLNNFFTDSLL------------------------------- 286
              |:..|....|:          |.::|  .|||                               
  Fly   215 --FNQFQRAPPHMLPHGMAGMYSPSSSF--QSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHM 275

  Rat   287 -----TGTTNGHAFE-------------------------------------------------- 296
                 |...:|||.:                                                  
  Fly   276 LASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTS 340

  Rat   297 -----------------------------TKPEFERRSSSIAVLRMKAKEH 318
                                         |.|| :||:||||.||:||:||
  Fly   341 PVALTLSHSPQRQLPPPSHQAPPPPPRAATPPE-DRRTSSIAALRLKAREH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 39/52 (75%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 40/279 (14%)
OAR 302..319 CDD:281777 12/17 (71%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 10/13 (77%)
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777 12/17 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44419
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.