DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp1b3 and GABA-B-R1

DIOPT Version :9

Sequence 1:NP_037045.1 Gene:Atp1b3 / 25390 RGDID:2172 Length:279 Species:Rattus norvegicus
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster


Alignment Length:115 Identity:26/115 - (22%)
Similarity:42/115 - (36%) Gaps:28/115 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 IYN---------PTSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLNDEVPKYRDQ 75
            |||         |.......:...|:..:.| .::|..||:.|..|            |||..:.
  Fly   681 IYNVVVLCLITAPVGMVIASQQDASFAFVAL-AVIFCCFLSMLLIF------------VPKVIEV 732

  Rat    76 IPSPGLMVFPK--PPTALDYTYSMSDPHTYKKFVEDLKNFLKPYSVEEQK 123
            |..|......|  |.:|:    |..|...|:|.|.:.:...:..:.:|:|
  Fly   733 IRHPKDKAESKYNPDSAI----SKEDEERYQKLVTENEELQRLITQKEEK 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp1b3NP_037045.1 Na_K_ATPase_bet 1..279 CDD:273446 26/115 (23%)
immunoglobulin-like. /evidence=ECO:0000250 186..279
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.