DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Atf3

DIOPT Version :9

Sequence 1:NP_037044.1 Gene:Atf3 / 25389 RGDID:2165 Length:181 Species:Rattus norvegicus
Sequence 2:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster


Alignment Length:194 Identity:66/194 - (34%)
Similarity:94/194 - (48%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 HPGQVSASEVSATAIV---PCLSPPGSLVFEDFANLTP--------FVKEELRFAIQNK------ 52
            ||...|.|:.|:.:..   |..||.|:..       ||        .:||.|:.:||:|      
  Fly    82 HPNGQSHSQDSSHSSCSGSPLDSPAGTAT-------TPSVQQTCSRLIKEGLKLSIQSKRKLSTC 139

  Rat    53 -------------------HLCHRMSSALESVTINN----------RPLEMSVTKSE---VAPEE 85
                               |..|..||...|.:::|          ...:.|.|||:   :.||:
  Fly   140 DSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKGLTPED 204

  Rat    86 DERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLH 149
            ::|:|||||||||||.|||.||:|:|:.|.||||.|::.|.|||.|:.:|:.|:|.|:.||..|
  Fly   205 EDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_037044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..96 11/22 (50%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 88..110 17/21 (81%)
bZIP_ATF3 96..149 CDD:269870 29/52 (56%)
coiled coil 96..140 CDD:269870 25/43 (58%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 114..142 14/27 (52%)
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 6/12 (50%)
coiled coil 215..265 CDD:269870 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336962
Domainoid 1 1.000 75 1.000 Domainoid score I8840
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.