DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arrb2 and Arr2

DIOPT Version :9

Sequence 1:NP_037043.1 Gene:Arrb2 / 25388 RGDID:2157 Length:410 Species:Rattus norvegicus
Sequence 2:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster


Alignment Length:403 Identity:174/403 - (43%)
Similarity:263/403 - (65%) Gaps:13/403 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat     8 RVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVL 72
            :||||::||.|:|.|||:|||:||:|..||||||::|:|||||:||||..|...:|||||:.:|:
  Fly     6 KVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVM 70

  Rat    73 GLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDT 137
            |:.|.|:|.:...| ..||.||....|.:|::|::|||.:|:||.|..|.|.|.|||||...:|.
  Fly    71 GVKFSKELILCREQ-IVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDN 134

  Rat   138 GKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQ-PSAETTRHFLMSDRRSLHL 201
            ||..||::.||||...|.:::.|||:.|.|:|:|:|:||...|.: ||:..::.|..|:.: :.|
  Fly   135 GKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGK-ISL 198

  Rat   202 EASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDD--QV 264
            |.:||:|:|||||.....|.|:|||.|:||.|:..:.|:.:|.:.: ||:...|||||..:  .:
  Fly   199 EVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVN-AQFSKHVAQLETKEGCPI 262

  Rat   265 SPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEG-ANKEVLGILVSYRVKVK 328
            :|.:...|.:.:.||.::|:::.|:||||.||.||.||||||:|:|| :..:..||::||.|::|
  Fly   263 TPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIK 327

  Rat   329 L-VVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAPREIDIPVDTNLIEFDTNYATDDD-IVFED 391
            | ..:.||::..::||.|:.|.| ..|...|..:..:...|....|:..:   |..||| |||||
  Fly   328 LNCGTLGGEMQTDVPFKLLQPAP-GTIEKKRSNAMKKMKSIEQHRNVKGY---YQDDDDNIVFED 388

  Rat   392 FARLRLKGMKDDD 404
            ||::|:..:...|
  Fly   389 FAKMRMNNVNMAD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arrb2NP_037043.1 Arrestin_N 19..175 CDD:278754 78/155 (50%)
Arrestin_C 199..350 CDD:214976 64/154 (42%)
Interaction with TRAF6. /evidence=ECO:0000250 241..410 62/169 (37%)
Interaction with AP2B1 378..410 13/28 (46%)
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250 386..396 8/10 (80%)
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 78/155 (50%)
Arrestin_C 192..350 CDD:214976 65/159 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.