DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arrb2 and Arr1

DIOPT Version :9

Sequence 1:NP_037043.1 Gene:Arrb2 / 25388 RGDID:2157 Length:410 Species:Rattus norvegicus
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:347 Identity:151/347 - (43%)
Similarity:233/347 - (67%) Gaps:6/347 - (1%)


- Green bases have known domain annotations that are detailed below.


  Rat     8 RVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLK-DRKVFVTLTCAFRYGREDLDV 71
            :||||.|||..:|:|:.:|||||.:.:|:|:||::::|.:|:: :||:||.|.|.|||||||.::
  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70

  Rat    72 LGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPED 136
            :||.|:|:|.:.:.|..||.....: .|::|:|||||||.:|:||...:|.:.|.||.||....|
  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134

  Rat   137 TGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHL 201
            ..:.|||.:.::.|...|..::||:|:::.|.|||||:||...|.||.....:.||:|. ..|.|
  Fly   135 ESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSP-GELEL 198

  Rat   202 EASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDD--QV 264
            |.:|||:||:|||.::||:.|.|||.|.||||:..|:|..|:.||...|::..:|.:|..:  .:
  Fly   199 EVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPL 263

  Rat   265 SPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKL 329
            :|.|:..||..:.|.|..|.::.|:|::|.:|.:||.|||:|::.....::..||:|||.|||||
  Fly   264 NPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKL 328

  Rat   330 VV-SRGGDVSVELPFVLMHPKP 350
            .: :.||::..||||:||||||
  Fly   329 FLGALGGELCAELPFILMHPKP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arrb2NP_037043.1 Arrestin_N 19..175 CDD:278754 67/156 (43%)
Arrestin_C 199..350 CDD:214976 67/153 (44%)
Interaction with TRAF6. /evidence=ECO:0000250 241..410 45/113 (40%)
Interaction with AP2B1 378..410
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250 386..396
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 67/156 (43%)
Arrestin_C 192..350 CDD:214976 68/158 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.