DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arrb1 and Arr1

DIOPT Version :9

Sequence 1:XP_038957542.1 Gene:Arrb1 / 25387 RGDID:2156 Length:481 Species:Rattus norvegicus
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:365 Identity:164/365 - (44%)
Similarity:237/365 - (64%) Gaps:19/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat    60 RVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRGPSSVPLLLTVYVTLTCAF 124
            :||||.|||..:|:|:.:|||||.:..|:|:||::::|.||:::.|         .::|.|.|.|
  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNR---------KIFVQLVCNF 61

  Rat   125 RYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCS 189
            ||||||.:::||.|:|:|.:.:.|..||..:|.: ||::||||:||||.:||||..::||:.|.|
  Fly    62 RYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPAS 125

  Rat   190 VTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFL 254
            |.||....|..:.|||.|.||.|..::..::.|:|:::.|.||||||||.:.|.||.....:.||
  Fly   126 VVLQQKASDESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFL 190

  Rat   255 MSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAME 319
            :|...|.||.:|||::|:|||.||||:.|.||:||.|||||..|:|..|:.||...|::..:|..
  Fly   191 LSPGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFM 255

  Rat   320 EADD--TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIV 382
            |..:  .:.|.|:..||..|.|.|..|.::.|:|::|.:|.:||.|||:||:.....|:..||||
  Fly   256 ETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIV 320

  Rat   383 SYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE 422
            ||.|||||.:  |.|.|:|.:     ||||.||||||..:
  Fly   321 SYAVKVKLFL--GALGGELCA-----ELPFILMHPKPSRK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arrb1XP_038957542.1 Arrestin_N 71..237 CDD:395268 71/165 (43%)
Arrestin_C 256..419 CDD:214976 76/164 (46%)
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 71/165 (43%)
Arrestin_C 192..350 CDD:214976 76/164 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.