DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC20 and CG4956

DIOPT Version :9

Sequence 1:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:297 Identity:68/297 - (22%)
Similarity:115/297 - (38%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    12 RVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENG---KTVVYLVAFHLFFVMFVWSYWMTI 73
            :|:|.:......|::......:|.|||.......:.:|   |...::..:.:..::..|  |:..
  Fly    36 KVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNW--WLGC 98

Human    74 FTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDR 138
            .|:.:..|                ...|||..:...|            ....||..||.:.|.|
  Fly    99 MTNTSVDS----------------LVLERQYPVAGEA------------HLWHYCSTCQKLVPPR 135

Human   139 AHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEY-FIKFWTNEL- 201
            :.|||.|:.||||.||||.:..:|:|..|.::||.|    |.:..|.:...|.| .|..|||:. 
  Fly   136 SWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAF----LFHLSFGSGQALVYNGILNWTNKAF 196

Human   202 ----------------TDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTF 250
                            .|.:.|:.:..||.::...|...|.:|.:...:|.:|.|          
  Fly   197 LVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNST---------- 251

Human   251 SYGPDGNGFSLGCSKNWRQVFGDEKKYWLL--PIFSS 285
            .|......:.:|..:|:..|.| ::::|:.  |..||
  Fly   252 CYKMLDRSYDVGWRRNFDMVLG-KRRFWIFFSPTISS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 66/293 (23%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.