DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC20 and CG13029

DIOPT Version :9

Sequence 1:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens
Sequence 2:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster


Alignment Length:190 Identity:50/190 - (26%)
Similarity:79/190 - (41%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   127 YCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLE 191
            :|:.||::.|.|:.||..|:.|||:.||||.:...|||.:||::|..|.:|..:..|...||.:.
  Fly   106 FCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVN 170

Human   192 YFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFS----- 251
            ..|       .|.:.:...:.|.|.....|:..:|     |.|:..|.:.|.:..|...|     
  Fly   171 LLI-------IDEQIRRQYVVLHFSRFFLFLKPMS-----CELIALNISFIINIYACILSLIMLG 223

Human   252 ------------YGPDGNGFSLGCSKNWRQVFGDEKKYWLL---PIFSSL-GDGCSFPTR 295
                        |.|....::.|...|:....| ::..|..   .|.|.| .||..:.|:
  Fly   224 YQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMG-KRGLWTFISPSIRSPLPHDGTKWQTK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 50/190 (26%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.