DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC20 and CG4483

DIOPT Version :9

Sequence 1:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:336 Identity:78/336 - (23%)
Similarity:135/336 - (40%) Gaps:99/336 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    11 QRVVGWVPV--LFITFVVVWSYYAYVVELCVFTIFGNE---ENGKTVVYLVAFHLFFVM---FVW 67
            :|.:.|.|:  |.:|.:|.|:           .|..|.   ..|.::..::.:.|.::.   .::
  Fly    10 RRFIHWGPITLLTLTLIVTWT-----------VIHMNSMWWAPGSSLESVLNYALIWIQTFGTLY 63

Human    68 SYWMTIFTSPA-SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKC 131
            ::..::...|. .|.|           :..:.::::.                    .:::|.:|
  Fly    64 NFIRSLMVGPGFVPLK-----------WHPQLTKDKM--------------------FLQFCTRC 97

Human   132 QLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLY----SLLYCLFVAATVLEY 192
            ...|..|:|||..|:.|::||||||||:|.|||:||...|:.|||:    |:...:.:.:.|:..
  Fly    98 NGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRG 162

Human   193 FIKFW----------TNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIE---- 243
            ..|.|          |..||.|.....|..|..:......|:..|:.....:: ||:|.||    
  Fly   163 IKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSIL-KNQTEIENWIV 226

Human   244 ---SFRA---PTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPE 302
               :||.   |.....|....::||...|.|:||           ||: |||.|:|.        
  Fly   227 KKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVF-----------FST-GDGISWPV-------- 271

Human   303 QASVTNQNEYA 313
               :.:.|||:
  Fly   272 ---LPDCNEYS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 74/317 (23%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/156 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.