DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC20 and CG8314

DIOPT Version :9

Sequence 1:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:294 Identity:82/294 - (27%)
Similarity:124/294 - (42%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     8 RCCQR--------------VVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAF 58
            |||..              ::.|:.:||..|||:    ..::....:|:|      .|:..::..
  Fly    24 RCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVM----RLILLPSNYTVF------STINMIIFQ 78

Human    59 HLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASK 123
            .|.|:.|. |:..|:.:.|.:..:    .|:.||..|:...:|.|.           .|.     
  Fly    79 ALAFLAFA-SHIRTMLSDPGAVPR----GNATKEMIEQMGYREGQM-----------FYK----- 122

Human   124 TIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSL---LYCLFV 185
                |.||..|||:||||||.|..||.||||||||||||||.:|.|:|:||..|..   ::.||:
  Fly   123 ----CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL 183

Human   186 AATVLEYFIK-FW--TNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRA 247
            ..|.....:| .|  .:..:.....|.:|||.|...||.|..:.:.:.....:..::|.||..:.
  Fly   184 VLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKK 248

Human   248 PTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLP 281
            ....:.....      .|:.:.|||.....|..|
  Fly   249 EEARWAKKSR------LKSIQSVFGRFSLAWFSP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 79/272 (29%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 51/135 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.