DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC20 and CG2611

DIOPT Version :9

Sequence 1:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens
Sequence 2:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster


Alignment Length:97 Identity:27/97 - (27%)
Similarity:38/97 - (39%) Gaps:29/97 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   157 PWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWT-NELTDT--RAKFHVLFLFFVSA 218
            ||          |..::.||      ||:...|.   |.|.| |.:|||  .....|..|..:.|
  Fly    55 PW----------KTIIIILL------LFIGGIVC---IAFATLNWVTDTSRERSDRVWALGIIGA 100

Human   219 MFFIS----VLSLFSYHCWLVGKNRTTIESFR 246
            :.||.    |..||   |.::.:|..|::..|
  Fly   101 LTFIPGSYYVYVLF---CIMLNRNGFTMDEIR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 27/97 (28%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.