Sequence 1: | NP_001316988.1 | Gene: | ZDHHC20 / 253832 | HGNCID: | 20749 | Length: | 365 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245821.1 | Gene: | CG17075 / 33191 | FlyBaseID: | FBgn0031239 | Length: | 968 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 44/209 - (21%) |
---|---|---|---|
Similarity: | 79/209 - (37%) | Gaps: | 66/209 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 12 RVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHL------------FFVM 64
Human 65 FVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCE 129
Human 130 KCQL-IKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLE-- 191
Human 192 --YFIK------FW 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZDHHC20 | NP_001316988.1 | zf-DHHC | 16..301 | CDD:327686 | 43/205 (21%) |
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 | 140..143 | 1/2 (50%) | |||
CG17075 | NP_001245821.1 | zf-DHHC | 199..>282 | CDD:279823 | 27/81 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |