DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adarb1 and stau

DIOPT Version :9

Sequence 1:XP_006256337.1 Gene:Adarb1 / 25367 RGDID:2033 Length:775 Species:Rattus norvegicus
Sequence 2:NP_476751.1 Gene:stau / 37065 FlyBaseID:FBgn0003520 Length:1026 Species:Drosophila melanogaster


Alignment Length:584 Identity:113/584 - (19%)
Similarity:177/584 - (30%) Gaps:221/584 - (37%)


- Green bases have known domain annotations that are detailed below.


  Rat    72 NMSSSSTDVKE---NRNLDNMPPKDSSTPGPGEGIPLSNG---GGGSTSRKRPLEEGSNGHSKYR 130
            |.:|:||.:..   .:...:..|:....|...:. .:|.|   ..|:.|.:.....|..|..|  
  Fly   249 NSTSNSTVIASEPVTQEDTSQKPETRQEPASADD-HVSTGNIDATGALSNEDTSSSGRGGKDK-- 310

  Rat   131 LKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAK 195
                    .|:...|.|.:.|:|..  ||.|..:.||.|...|.:::.:..:.:...|...|||:
  Fly   311 --------TPMCLVNELARYNKITH--QYRLTEERGPAHCKTFTVTLMLGDEEYSADGFKIKKAQ 365

  Rat   196 LHAAEKAL-RSFVQFP----NASE------AHL-------AMGRTLSVNTDFTSDQADFPDTLFN 242
            ..||.||: .:..:.|    ..||      .|:       |:...|...|.:..|....|.|   
  Fly   366 HLAASKAIEETMYKHPPPKIRRSEEGGPMRTHITPTVELNALAMKLGQRTFYLLDPTQIPPT--- 427

  Rat   243 GFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPP---------------LPIPP-- 290
                 |...||.:.|.:            |..:|.| .:.|||               :|||.  
  Fly   428 -----DSIVPPEFAGGH------------LLTAPGP-GMPQPPPPPAYALRQRLGNGFVPIPSQP 474

  Rat   291 ------------PFPP-------------------PSG--------------------------- 297
                        ||||                   |:|                           
  Fly   475 MHPHFFHGPGQRPFPPKFPSRFALPPPLGAHVHHGPNGPFPSVPTPPSKITLFVGKQKFVGIGRT 539

  Rat   298 -------------------------------------KNPVMILNELRPGLK------YDFLSES 319
                                                 |:|:..::|:  |:|      :..|.|.
  Fly   540 LQQAKHDAAARALQVLKTQAISASEEALEDSMDEGDKKSPISQVHEI--GIKRNMTVHFKVLREE 602

  Rat   320 GESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLP 384
            |.:|.|:|:.:.:|.....||.|..||::|.|||:..|                           
  Fly   603 GPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKML--------------------------- 640

  Rat   385 QVLADAVSRLVLGKFSDLTDNFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSD 449
                     :.|.|...||....:|..|.|     |.|.|.....|:..||.:||.........:
  Fly   641 ---------VELQKLPPLTPTKQTPLKRIK-----VKTPGKSGAAAREGSVVSGTDGPTQTGKPE 691

  Rat   450 RGLALNDCHAEIISRRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTS 513
            |...||....::|........:...::|....||  |:.||:...:.|.......:|.:.:|.|
  Fly   692 RRKRLNPPKDKLIDMDDADNPITKLIQLQQTRKE--KEPIFELIAKNGNETARRREFVMEVSAS 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adarb1XP_006256337.1 DSRM 143..206 CDD:238007 19/63 (30%)
DSRM 299..357 CDD:238007 20/63 (32%)
ADEAMc 386..772 CDD:214718 29/128 (23%)
stauNP_476751.1 DSRM 312..375 CDD:214634 20/64 (31%)
DSRM <529..555 CDD:294045 0/25 (0%)
DSRM 579..644 CDD:214634 21/102 (21%)
DSRM 712..780 CDD:214634 10/44 (23%)
Staufen_C <953..1020 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.