DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cntn2 and Nrg

DIOPT Version :10

Sequence 1:NP_037016.2 Gene:Cntn2 / 25356 RGDID:3821 Length:1040 Species:Rattus norvegicus
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:1118 Identity:302/1118 - (27%)
Similarity:476/1118 - (42%) Gaps:155/1118 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat     7 KKASLLLLVLATVALVSSPGWSFAQGTPATFGPIFEEQPI--GLLF----PEESAEDQVTLACRA 65
            :::::|..:|  |||:.: |.:.::|...   |...:||.  .|||    ..:.:::...:.|.|
  Fly     3 RQSTILAALL--VALLCA-GSAESKGNRP---PRITKQPAPGELLFKVAQQNKESDNPFIIECEA 61

  Rat    66 RASPPATYRWKMNG---------TDMNLEPGSRHQLMGGNLVIMSPTKTQDAGVYQCLASNPVGT 121
            ...|...|.|..||         ..|..:||.      |.|||..| |.:|.|.|||.|||..||
  Fly    62 DGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGR------GTLVITIP-KDEDRGHYQCFASNEFGT 119

  Rat   122 VVSKEAVLRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDG--- 183
            ..|....:|...|..|..|....::..||...||.|..|..:|..:..|::.|     ..||   
  Fly   120 ATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQE-----SIDGSIK 179

  Rat   184 ----RHFVSQTTGNLY---IARTNASDLGNYSCLATSHMDFSTK---SVFSKFAQLNLAAEDPRL 238
                ........|||:   :.|.:||....|:|.|||......|   .|.....|:.::|.    
  Fly   180 SINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSAS---- 240

  Rat   239 FAPSIKARFPP--------ETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWATA------ 289
                 :.:.||        ::.||.|:::.|.|...|.|:|:..|.| ||. ..||:..      
  Fly   241 -----QNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSK-DGQ-RIQWSDRITQGHY 298

  Rat   290 EPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII-VQAQPEWLKVISDTEADIGSNLRWGCAAA 353
            ..:|.|...:|:|.|||.|:..|..|.......|: |.:.|.:.|......|.....:.:.|.||
  Fly   299 GKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAA 363

  Rat   354 GKPRPMVRWLRNGEPLASQN---RVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQ 415
            |.|.|.:.|:.||:|:....   |..|....:|...|...|:|.|.|.|.|..|.:|....|.||
  Fly   364 GVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQ 428

  Rat   416 ALAPDFRQNPVRRLIPAARGGEISILCQPRAAPKATILWSKGTEILGNSTRVTVTSDGTLIIRNI 480
            |..|...:.|.  .:....|..::|.|:...:||..:.|.:.:..| ...|..|.::|.|.|:::
  Fly   429 AEPPTISEAPA--AVSTVDGRNVTIKCRVNGSPKPLVKWLRASNWL-TGGRYNVQANGDLEIQDV 490

  Rat   481 SRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGDNLTLQCHASHDPTMDLTFT 545
            :.||.|||||:|:|..|:..:.|.|.|::.|:||..|.:.::..|.:.|.:|:.:||.|:::...
  Fly   491 TFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEID 555

  Rat   546 WTLDDFPIDFDKPGGHYRRASAKETIGDLTILNAQLRHGGKYTCMAQTVVDGTSKEATVLVRGPP 610
            |..|...|||:.     :....|.....|||........|:|||:|:|.:|..:..|.::|:..|
  Fly   556 WWKDGQSIDFEA-----QPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVP 615

  Rat   611 GPPGGVVVRDIGDTTVQLSWSRGFDNHSPIAKYTLQ---ARTPPS--GKWKQVRTNPVNIEGNAE 670
            ..|....:....| ..::.|.:..||.|||..||:|   :.||.|  ..:::|        .|.:
  Fly   616 NAPKLTGITCQAD-KAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKV--------PNTD 671

  Rat   671 TAQVLGLMPWMDYEFRVSASNILGTGEPSGPSSKIRTKEAVPSVAPSGLSGGGGAPGELIINWTP 735
            ::.|:.:.||.:|.|||.|.|.:|...||..|....|:..||...|..:.|.|..|..|:|:|||
  Fly   672 SSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTP 736

  Rat   736 VSREYQNGDGFGYLLSFRRQ-GSSSWQTARVPGADAQYFVYGNDSI----QP-YTPFEVKIRSYN 794
            :.....|...|.|.:|::|. .:::|:...:       |.:..::|    || :..:.:|:.:.|
  Fly   737 MPEIEHNAPNFHYYVSWKRDIPAAAWENNNI-------FDWRQNNIVIADQPTFVKYLIKVVAIN 794

  Rat   795 RRGDGPESLTALV-YSAEEEPRVAPAKVWAKG-SSSSEMNVSWEPVLQD-MNGILLGYEIRYWKA 856
            .||:...:...:| ||.|:.|..||.....:. :||:...::|.||.:: :.|...||:|:.|..
  Fly   795 DRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTWTE 859

  Rat   857 GDNEAAADRVRTAGLDTSARVTGLNPNTKYHVTVRAYNRAGTGPASPSADAMTVKPPPRRPPGNI 921
            .:.|.....:...|...:|.||...|::|.:..:.|||....||.|...|..|.:..|....|..
  Fly   860 NEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLD 924

  Rat   922 SWTFSSSSLSLKWDPVVPLRNESTVTGYKMLYQN------------DLHPTPT---------LHL 965
            ::...||:..|.|..  ||.....:||||:.|:.            |.|.|..         |..
  Fly   925 AYPLGSSAFMLHWKK--PLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKP 987

  Rat   966 TSKNWIEIPVPEDIGHA------------LVQIRTTGP--GGDGIPAEVHIVRNGGTSMMVESAA 1016
            .||..|.|.....:|..            .|.:....|  ..:.:|::     ||.....:....
  Fly   988 NSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWEQLPSD-----NGLAKFRINWLP 1047

  Rat  1017 ARPAHPGPAFSCM 1029
            :...|||..|..|
  Fly  1048 STEGHPGTHFFTM 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cntn2NP_037016.2 Ig 37..133 CDD:472250 34/110 (31%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 95..99 CDD:409353 2/3 (67%)
Ig strand F 110..115 CDD:409353 3/4 (75%)
Ig strand G 124..127 CDD:409353 1/2 (50%)
Ig2_Contactin-2-like 141..230 CDD:409392 25/101 (25%)
Ig strand A 143..148 CDD:409392 0/4 (0%)
Ig strand B 152..158 CDD:409392 2/5 (40%)
Ig strand C 166..172 CDD:409392 1/5 (20%)
Ig strand C' 177..179 CDD:409392 0/1 (0%)
Ig strand D 184..189 CDD:409392 0/4 (0%)
Ig strand E 192..196 CDD:409392 3/6 (50%)
Ig strand F 206..214 CDD:409392 4/7 (57%)
Ig strand G 218..230 CDD:409392 3/14 (21%)
Ig 241..326 CDD:472250 27/99 (27%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 291..295 CDD:409353 1/3 (33%)
Ig strand F 305..310 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353 0/2 (0%)
Ig4_Contactin-2-like 330..414 CDD:143205 25/86 (29%)
Ig strand A 330..333 CDD:143205 0/2 (0%)
Ig strand A' 337..341 CDD:143205 0/3 (0%)
Ig strand B 345..353 CDD:143205 1/7 (14%)
Ig strand C 359..364 CDD:143205 1/4 (25%)
Ig strand C' 366..369 CDD:143205 1/2 (50%)
Ig strand D 374..378 CDD:143205 1/3 (33%)
Ig strand E 380..385 CDD:143205 1/4 (25%)
Ig strand F 394..401 CDD:143205 3/6 (50%)
Ig strand G 405..414 CDD:143205 2/8 (25%)
Ig5_Contactin 419..507 CDD:409358 26/87 (30%)
Ig strand A 419..424 CDD:409358 1/4 (25%)
Ig strand A' 427..432 CDD:409358 0/4 (0%)
Ig strand B 436..443 CDD:409358 1/6 (17%)
Ig strand C 451..455 CDD:409358 0/3 (0%)
Ig strand D 469..472 CDD:409358 1/2 (50%)
Ig strand E 473..478 CDD:409358 2/4 (50%)
Ig strand F 486..494 CDD:409358 6/7 (86%)
Ig strand G 500..507 CDD:409358 2/6 (33%)
Ig 509..605 CDD:472250 27/95 (28%)
Ig strand B 528..532 CDD:409353 1/3 (33%)
Ig strand C 543..547 CDD:409353 0/3 (0%)
Ig strand E 572..576 CDD:409353 1/3 (33%)
Ig strand F 586..591 CDD:409353 3/4 (75%)
Ig strand G 599..602 CDD:409353 0/2 (0%)
FN3 620..707 CDD:238020 28/91 (31%)
FN3 728..802 CDD:238020 19/79 (24%)
Cell attachment site. /evidence=ECO:0000255 796..798 1/1 (100%)
FN3 817..909 CDD:238020 26/93 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..921 7/25 (28%)
NrgNP_001245581.1 Ig 29..128 CDD:472250 33/105 (31%)
Ig strand B 55..59 CDD:409353 0/3 (0%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 108..113 CDD:409353 3/4 (75%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 137..216 CDD:472250 21/83 (25%)
Ig strand B 151..155 CDD:409353 2/3 (67%)
Ig strand C 165..169 CDD:409353 0/3 (0%)
Ig strand E 192..196 CDD:409353 3/3 (100%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
ig 251..332 CDD:395002 24/82 (29%)
Ig strand B 264..268 CDD:409353 1/3 (33%)
Ig strand C 277..281 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 26/87 (30%)
Ig strand A 339..342 CDD:409570 1/2 (50%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 1/6 (17%)
Ig strand C 369..374 CDD:409570 1/4 (25%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/3 (33%)
Ig strand E 393..397 CDD:409570 0/3 (0%)
Ig strand F 406..414 CDD:409570 4/7 (57%)
Ig strand G 417..427 CDD:409570 3/9 (33%)
Ig 446..517 CDD:472250 24/71 (34%)
Ig strand B 449..453 CDD:409358 1/3 (33%)
Ig strand C 462..466 CDD:409358 0/3 (0%)
Ig strand E 483..487 CDD:409358 2/3 (67%)
Ig strand F 497..502 CDD:409358 4/4 (100%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 28/98 (29%)
Ig strand B 538..542 CDD:409353 1/3 (33%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 1/3 (33%)
Ig strand F 591..596 CDD:409353 3/4 (75%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 30/102 (29%)
FN3 683..>1051 CDD:442628 95/381 (25%)
fn3 817..905 CDD:394996 24/87 (28%)
fn3 918..1007 CDD:394996 21/90 (23%)
FN3 1041..1111 CDD:238020 5/20 (25%)
Bravo_FIGEY 1155..>1221 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.