DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM2 and dpr6

DIOPT Version :9

Sequence 1:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:358 Identity:79/358 - (22%)
Similarity:129/358 - (36%) Gaps:99/358 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    44 QNVTVVEGGTAILTCRVDQNDNTSLQWSN-------PAQQTLYFDDKKALRDNRIELVRASWH-- 99
            :|||.:.|.:|.|:|||....|.::.|..       ......|..|::         .:|:.|  
  Fly    81 RNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQR---------FQATHHQD 136

Human   100 --ELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKT 162
              :.::.:......|.|.|.|.:.|.||::....|.|: ||....:.|....|.:|..:.|||..
  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVV-VPTATILGGPDLHVDKGSTINLTCTV 200

Human   163 SGS-KPAADIRWFKNDKEIK------DVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVD 220
            ..| :|.|.|.|:.:::.|.      .|..:.|    :...|.|..|....|.:|.|        
  Fly   201 KFSPEPPAYIFWYHHEEVINYDSSRGGVSVITE----KGDVTTSFLLIQNADLADSG-------- 253

Human   221 HESLNATPQVA-MQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPD 284
              ..:..|..| :..:.:|.. :|:.|.|                               ||.|:
  Fly   254 --KYSCAPSNADVASVRVHVL-NVRAIIS-------------------------------GEHPE 284

Human   285 PDRMVVSGRELN----ILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTI-IPSLT 344
            ..:...||.:.|    :|.|     |...|.::...  |||....:...:|   ||:.: :|:..
  Fly   285 AMQTGSSGCQYNWLTIVLLL-----GLVLCYSSQQC--SSAVPASLTSSLP---LPSQLPLPAAA 339

Human   345 TATVTTT---------VAITTSPTTSATTSSIR 368
            .||.|.|         .|...|..|:.||::.|
  Fly   340 AATTTATGESASSESVTAARASAATTTTTTATR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM2XP_016861551.1 None
dpr6NP_001287018.1 V-set 79..174 CDD:284989 23/101 (23%)
IG_like 80..175 CDD:214653 24/103 (23%)
IG_like 184..271 CDD:214653 21/100 (21%)
IGc2 191..262 CDD:197706 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.