DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM2 and side-VIII

DIOPT Version :9

Sequence 1:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:473 Identity:104/473 - (21%)
Similarity:176/473 - (37%) Gaps:120/473 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    17 LLLQGKHINHSSVIRLHQGSQGQFPLTQNVTVVEGGTAIL----------TCRVDQNDNTSLQWS 71
            |||.|..:...|::    |:.|:.|......:.|...|::          ...||..|      |
  Fly    51 LLLAGPPVLSESIM----GTVGRLPCNVTPPIYEDRVALVIWYKVGLKTPIYSVDTRD------S 105

Human    72 NPAQQTLYFDDKKALRDNRIELVRASWH----ELSISVSDVSLSDEGQYTC--SLFTMPVKTSKA 130
            |.||.|.:.|:  ..|:      |.|:|    ..::::...:..|.|:|.|  .....|.:.||.
  Fly   106 NFAQGTHWSDE--TYRE------RLSFHVEGRAGTLTIKSTTEDDTGEYRCRVDFQKSPTRNSKV 162

Human   131 YLTVLGVPEKPQI---SGFS------SPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL 186
            .|||:..||...|   .|.:      .|..||..:.:||...|.:|...:.|...:...|:....
  Fly   163 NLTVIIPPESVIILDSKGVTIEDHTLGPYNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNASVG 227

Human   187 KEEDANRKTFTVSSTLDF-RVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTP-SVKIIPST 249
            :.....|    |.:||.. |::|.:..:.:.||.::.:| .||.::..||:::..| .||:....
  Fly   228 QPLSERR----VGNTLSLARLERRNLHMQLTCRAENNNL-TTPIISSVVLDMNLRPLIVKLQGEN 287

Human   250 PFPQEGQPLILTCESKG-KPLPEPVLW-----TKDGGELPDPDRMVVSGRELNILFLNKT--DNG 306
            .....|....|:|...| :|.|....|     .|:..|:..||..:.:    ::|....|  |.|
  Fly   288 RALSAGNSYQLSCVVIGARPAPTITWWKGSTPMKNTHEIATPDGNLTT----SVLTFTPTIDDRG 348

Human   307 TY-RCEATNT-IGQSSAE--YVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSI 367
            .: .|.|..: |.:|..|  :.|.::.:|                     .::....|::..|::
  Fly   349 KFLSCRAEQSMIPESGMEDGWKLDIYHIP---------------------VVSLELGTNSLNSTL 392

Human   368 RDPNALAGQNGPDHALIGGIVAVVVFVTLCSIF---LLGRYLARHKGTYLTNE-AKG-------- 420
            |:                   .:.||.. |:|.   .:.....||.|..|||. |:|        
  Fly   393 RE-------------------GIDVFFE-CNIKSNPWIYEVSWRHNGKILTNNPAEGIAVSNQSL 437

Human   421 -AEDAPDADTAIINAEGS 437
             .::|..|.:.|....||
  Fly   438 VLQNASRARSGIYTCVGS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM2XP_016861551.1 None
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 28/128 (22%)
IG_like 60..166 CDD:214653 27/123 (22%)
Ig 182..266 CDD:299845 19/88 (22%)
Ig 296..373 CDD:299845 20/80 (25%)
IG_like 389..464 CDD:214653 19/87 (22%)
IGc2 394..459 CDD:197706 17/82 (21%)
Ig_3 490..554 CDD:290638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11207
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.