DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM2 and side-II

DIOPT Version :9

Sequence 1:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens
Sequence 2:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:120/280 - (42%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    50 EGGTAILTCR-VDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDE 113
            ||...::||| |.......::|   ....|..|::.......:...|..|.  |:..:|::    
  Fly   187 EGDDIVITCRVVGGRPQPQVRW---LVNGLLVDNQNEHNSGDVIENRLLWP--SVQRNDLN---- 242

Human   114 GQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSP---VMEGDLMQLTCKTSGSKPAADIRWFK 175
            ..:||......:...|....:|.:..||.:.....|   ::.....:::|::|||:|.|.|.|:|
  Fly   243 SVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYK 307

Human   176 NDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYT 240
            ..::::..|    :|.::.  :..|.|.|.....|||.::.||.::.::|......|..|.:.|.
  Fly   308 GKRQLRRTK----DDISKN--STRSELSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYP 366

Human   241 PSVKI-IPSTPFP---QEGQPLILTCESKGKPLPEPVLWTKDGGELP--DPDRMVVSGRELNILF 299
            |.|.: :.||..|   :||..:...|..:..|....:||..:|..|.  ...|::.|.:.|.:..
  Fly   367 PLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQSLVLQK 431

Human   300 LNKTDNGTYRCEATNTIGQS 319
            :.|...|.|.|.|.|..|::
  Fly   432 ITKHYAGNYACSAINDEGET 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM2XP_016861551.1 None
side-IINP_001014485.3 IG_like 55..160 CDD:214653
Ig 57..160 CDD:299845
Ig 188..251 CDD:299845 14/71 (20%)
Ig 289..363 CDD:299845 22/79 (28%)
IG_like 289..351 CDD:214653 19/67 (28%)
Ig_2 376..460 CDD:290606 20/76 (26%)
IG_like 383..454 CDD:214653 18/69 (26%)
Ig 470..548 CDD:299845
IG_like 481..557 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11207
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.