DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD2 and Corin

DIOPT Version :9

Sequence 1:NP_001457.1 Gene:FZD2 / 2535 HGNCID:4040 Length:565 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:209 Identity:56/209 - (26%)
Similarity:81/209 - (38%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    34 PDHGFCQPISIPLC--TDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMY 96
            |..|.|.||.:..|  ..|.||.|:.||.:||..|.:...::..:..||.|:|...:..|||:::
  Fly   774 PAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLF 838

Human    97 APVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAP 161
            .|.|......:|||:::|....:.|....:.||...||.|.|:.|....:.:.|||.:...:   
  Fly   839 VPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVRE--- 900

Human   162 ALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHP----FHCPRVLKVPSYLSYKFLGERDC- 221
                                       ..|.||  ||    |.|.:...:|.  .|...|..|| 
  Fly   901 ---------------------------VMRAAT--HPKCDGFQCDQNRCLPQ--EYVCDGHLDCM 934

Human   222 ----AAPCEPARPD 231
                .|.||...||
  Fly   935 DQADEAKCERCGPD 948

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD2NP_001457.1 CRD_FZ2 35..161 CDD:143573 38/127 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..189 0/28 (0%)
7tmF_FZD2 234..563 CDD:320373
TM helix 1 244..268 CDD:320373
TM helix 2 277..298 CDD:320373
TM helix 3 328..350 CDD:320373
TM helix 4 371..387 CDD:320373
TM helix 5 409..432 CDD:320373
TM helix 6 463..485 CDD:320373
TM helix 7 514..539 CDD:320373
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 543..548
PDZ-binding 563..565
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 35/115 (30%)
LDLa 911..942 CDD:238060 8/32 (25%)
LDLa 945..979 CDD:238060 2/4 (50%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.