DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD2 and smo

DIOPT Version :9

Sequence 1:NP_001457.1 Gene:FZD2 / 2535 HGNCID:4040 Length:565 Species:Homo sapiens
Sequence 2:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster


Alignment Length:529 Identity:124/529 - (23%)
Similarity:216/529 - (40%) Gaps:120/529 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    63 HTNQEDAGLEVHQFYPLVKV-QCSPELRFFLCSMYAPVCTVL---EQAIPPCRSICERARQGCEA 123
            ||.:| ...:::.:|.|..| :|...::.|||:::.|.|..:   :....|...:|....:.|..
  Fly   118 HTEKE-LNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRI 181

Human   124 LMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGA 188
            |.|...|  |:.|||..                         |..|.....||.|          
  Fly   182 LYNTTFF--PKFLRCNE-------------------------TLFPTKCTNGARG---------- 209

Human   189 PPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF--------------FSQE 239
                                    .||.|...|.:|..|.....|.:              ::.:
  Fly   210 ------------------------MKFNGTGQCLSP
LVPTDTSASYYPGIEGCGVRCKDPLYTDD 250

Human   240 ETRFARLWILTWS-VLCCASTFFTVTTYLVDMQRF-RYPERPIIFLSGCYTMVSVAYIAGFV--L 300
            |.|.... ::.|: .:|..|..|.|:|:.:|.:.. :||...:.:::.|:.:..|.::..|.  .
  Fly   251 EHRQIHK-LIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACVGWLLQFTSGS 314

Human   301 QERVVCNERFSEDGYRTVVQGTKKE--GCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGH- 362
            :|.:||.    :||.....:.|..|  .|.::|:::|:|..|..:|:|.|:..|...|   .|| 
  Fly   315 REDIVCR----KDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA---MGHV 372

Human   363 -EAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFI 426
             :.|:....||||.||::|.|.|||.:|..::||:.:.|:||||..:.....|.:|.||...:.|
  Fly   373 QDRIDKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILI 437

Human   427 GTSFLLAGFVSLFRIRTIMKH------DGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQA 485
            |..|:..|.|.||.    :||      ..:.:.|:..:::|:||.::|..|...:.|||:..|..
  Fly   438 GGYFITRGMVMLFG----LKHFANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAIACHVTEFR 498

Human   486 FREHWERSWVSQH--CKSLAIPCPAHYTPRMS------PDFTVYMIKYLMTLIVGITSGFWIWSG 542
            ..:.|.:|: .|.  ||..::     :..:.|      |...|..:..|.....||....|.|:.
  Fly   499 HADEWAQSF-RQFIICKISSV-----FEEKSSCRIENRPSVGVLQLHLLCLFSSGIVMSTWCWTP 557

Human   543 KTLHSWRKF 551
            .::.:|:::
  Fly   558 SSIETWKRY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD2NP_001457.1 CRD_FZ2 35..161 CDD:143573 22/101 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..189 5/28 (18%)
7tmF_FZD2 234..563 CDD:320373 90/354 (25%)
TM helix 1 244..268 CDD:320373 6/24 (25%)
TM helix 2 277..298 CDD:320373 2/20 (10%)
TM helix 3 328..350 CDD:320373 7/21 (33%)
TM helix 4 371..387 CDD:320373 10/15 (67%)
TM helix 5 409..432 CDD:320373 7/22 (32%)
TM helix 6 463..485 CDD:320373 8/21 (38%)
TM helix 7 514..539 CDD:320373 6/30 (20%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 543..548 0/4 (0%)
PDZ-binding 563..565
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 31/164 (19%)
Frizzled 246..568 CDD:279827 90/339 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.