powered by:
Protein Alignment FYN and PIN3
DIOPT Version :9
Sequence 1: | NP_001357458.1 |
Gene: | FYN / 2534 |
HGNCID: | 4037 |
Length: | 537 |
Species: | Homo sapiens |
Sequence 2: | NP_015480.1 |
Gene: | PIN3 / 856277 |
SGDID: | S000006358 |
Length: | 215 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 19/55 - (34%) |
Similarity: | 29/55 - (52%) |
Gaps: | 2/55 - (3%) |
- Green bases have known domain annotations that are detailed below.
Human 89 ALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDS 143
|||.::.:.:.||....|:|.|:|.....:|: :....|.||..|:|||.|..|
Yeast 61 ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRTGIFPANYVKPAFS 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000006 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.