DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FYN and BCK1

DIOPT Version :9

Sequence 1:NP_001357458.1 Gene:FYN / 2534 HGNCID:4037 Length:537 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:73/275 - (26%)
Similarity:126/275 - (45%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   277 LGNGQFGEVWMGTWNGNT--KVAIKTLKPGTMSP---------ESFLEEAQIMKKLKHDKLVQLY 330
            :|.|.||.|:: ..|..|  .:|:|.::....|.         |:...|...:|.|.|..:||..
Yeast  1181 IGKGSFGAVYL-CLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYL 1244

Human   331 AVVSEEPIY-IVTEYMNKGSLLDFLKDGEGRALKL------PNLVDMAAQVAAGMAYIERMNYIH 388
            ...::..|| :..||:..||:        |..:::      |.:..:..||..|:||:.....:|
Yeast  1245 GFENKNNIYSLFLEYVAGGSV--------GSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILH 1301

Human   389 RDLRSANILVGNGLICKIADFGLARLIED---NEYTARQGAKFPIKWTAPEAA-LYGRFTIKSDV 449
            ||:::.|:|:....||||:|||::|..:|   |.....:|..|   |.|||.. ....::.|.|:
Yeast  1302 RDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVF---WMAPEMVDTKQGYSAKVDI 1363

Human   450 WSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRM-------PCPQDCPISLHEL----MIHCW 503
            ||.|.::.|:.. |:.|:..      ||.|...:::       |.|:|....:.::    :..|:
Yeast  1364 WSLGCIVLEMFA-GKRPWSN------LEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACF 1421

Human   504 KKDPEERPTFEYLQS 518
            :.:||:|||...|.|
Yeast  1422 EINPEKRPTANELLS 1436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FYNNP_001357458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..35
SH3_Fyn_Yrk 85..140 CDD:212939
SH2_Src_Fyn_isoform_a_like 145..245 CDD:198281
PTKc_Fyn 261..534 CDD:270655 73/275 (27%)
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 73/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.