DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FYN and skb5

DIOPT Version :9

Sequence 1:	NP_001357458.1	Gene:	FYN / 2534	HGNCID:	4037	Length:	537	Species:	Homo sapiens
Sequence 2:	NP_588016.1	Gene:	skb5 / 2539237	PomBaseID:	SPCC24B10.13	Length:	140	Species:	Schizosaccharomyces pombe

Alignment Length:	51	Identity:	18/51 - (35%)
Similarity:	29/51 - (56%)	Gaps:	0/51 - (0%)

- Green bases have known domain annotations that are detailed below.

Human    88 VALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYV 138
            |||||:|...:::|.|..|::..||:.|...|..|....:|.:|.:|..:|
pombe    86 VALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFV 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FYN	NP_001357458.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	14..35
		SH3_Fyn_Yrk	85..140	CDD:212939	18/51 (35%)
		SH2_Src_Fyn_isoform_a_like	145..245	CDD:198281
		PTKc_Fyn	261..534	CDD:270655
skb5	NP_588016.1	SH3_Nbp2-like	84..138	CDD:212799	18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	42	1.000	Domainoid score	I4126
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000006
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910