DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bhlha15 and twi

DIOPT Version :9

Sequence 1:NP_036995.1 Gene:Bhlha15 / 25334 RGDID:3091 Length:197 Species:Rattus norvegicus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:137 Identity:45/137 - (32%)
Similarity:66/137 - (48%) Gaps:19/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    22 GEQTP----DRSQSGS---GASEVTKGLRSRTARASGTRAEVSRRRQGSSSRRENSVQRRLESNE 79
            |..:|    |...:||   |:....|..|....|.        :|:...:...:....:|:.:|.
  Fly   313 GVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRL--------KRKPSKTEETDEFSNQRVMANV 369

  Rat    80 RERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLEAPGP 144
            |||||...||:||::|:::||.:.:| |||||:||.||..||..|...:.:...|.|..|||.| 
  Fly   370 RERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQG- 432

  Rat   145 APGPKLY 151
              .|..|
  Fly   433 --SPSAY 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bhlha15NP_036995.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 13/66 (20%)
HLH 70..124 CDD:238036 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197
twiNP_001033967.1 HLH 363..413 CDD:278439 26/50 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.