Sequence 1: | NP_036995.1 | Gene: | Bhlha15 / 25334 | RGDID: | 3091 | Length: | 197 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001033967.1 | Gene: | twi / 37655 | FlyBaseID: | FBgn0003900 | Length: | 490 | Species: | Drosophila melanogaster |
Alignment Length: | 137 | Identity: | 45/137 - (32%) |
---|---|---|---|
Similarity: | 66/137 - (48%) | Gaps: | 19/137 - (13%) |
- Green bases have known domain annotations that are detailed below.
Rat 22 GEQTP----DRSQSGS---GASEVTKGLRSRTARASGTRAEVSRRRQGSSSRRENSVQRRLESNE 79
Rat 80 RERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLEAPGP 144
Rat 145 APGPKLY 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bhlha15 | NP_036995.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..82 | 13/66 (20%) | |
HLH | 70..124 | CDD:238036 | 26/53 (49%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 175..197 | ||||
twi | NP_001033967.1 | HLH | 363..413 | CDD:278439 | 26/50 (52%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |