DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cycs and Cyt-c-d

DIOPT Version :9

Sequence 1:NP_036971.1 Gene:Cycs / 25309 RGDID:2451 Length:105 Species:Rattus norvegicus
Sequence 2:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster


Alignment Length:99 Identity:73/99 - (73%)
Similarity:81/99 - (81%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
            ||.|.||||||||||||||.|.|||||.||||.|:.|||.|.|||:.|||||..||:||.|..|.
  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68

  Rat    67 EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            |||::||||||||||:|||:||..|||||||:||
  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycsNP_036971.1 Cytochrom_C 2..105 CDD:419674 73/99 (74%)
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 73/99 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.