DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEPACAM2 and Ama

DIOPT Version :9

Sequence 1:NP_001275733.1 Gene:HEPACAM2 / 253012 HGNCID:27364 Length:485 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:297 Identity:62/297 - (20%)
Similarity:112/297 - (37%) Gaps:50/297 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    87 IQIIWLFERPHTMP--KYLLGSVNKSVVPDLEYQHKFTMMPPNASLL----INPLQFPDEGNYIV 145
            :.:.|. :||....  ..:|...|...:||..|....|..|...|.:    |..::..|.|.|..
  Fly    62 LSVSWA-KRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYEC 125

Human   146 KVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVG-NMTLTCHVEGGTRLAYQWLKNG 209
            :|.:  :.|...::|:.:.:..|   ||:..:.|...:...| |:.||||..|..:....|.:..
  Fly   126 QVLV--SATEKVTKKLSLQIKTP---PVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREH 185

Human   210 RPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKG 274
            ..|..:..:..:  ..||.|..|.:.|.|.|.|:.:|...:.:..:|...:.:.|   |:...:.
  Fly   186 NAVMPAGGHLLA--EPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRP---QIAVQRP 245

Human   275 LKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRR------------------TDNTTYIIKHGPR 321
             |:.::    :..:...:||...:|..|..|.:.                  :..||.::    |
  Fly   246 -KIAQM----VSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVL----R 301

Human   322 LEVASEKVAQKTMDYVCCAYNNITGRQDETHF--TVI 356
            ::...|   :...||.|.|.|.:.......|.  |||
  Fly   302 IDSVGE---EDFGDYYCNATNKLGHADARLHLFQTVI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEPACAM2NP_001275733.1 Ig 128..>197 CDD:299845 18/73 (25%)
I-set 172..255 CDD:254352 21/83 (25%)
IGc2 190..249 CDD:197706 16/58 (28%)
AmaNP_731114.2 I-set 33..143 CDD:254352 18/83 (22%)
Ig 37..127 CDD:299845 15/65 (23%)
IG_like 154..234 CDD:214653 20/81 (25%)
IGc2 161..223 CDD:197706 18/63 (29%)
I-set 254..330 CDD:254352 14/82 (17%)
IGc2 254..322 CDD:197706 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.