DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEPACAM2 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001275733.1 Gene:HEPACAM2 / 253012 HGNCID:27364 Length:485 Species:Homo sapiens
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:431 Identity:88/431 - (20%)
Similarity:144/431 - (33%) Gaps:105/431 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    95 RPHTMPKYLLG---SVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLS 156
            ||||..::.|.   :|.:..:..:.......:|....:|    .:.|.:|.:.         .|.
  Fly    11 RPHTRRRFRLQAEFNVRQLAITIIATAAVTMLMTATPTL----AEIPSKGKHT---------RLD 62

Human   157 ASQKIQVTVDDP-VTKPVVQIHPPSGAVEYVGNMTLTCHVEG--GTRLAYQWLKNGRPVHTSSTY 218
            ..|..|...|.| ..:|:..:     .|....:..:.|.||.  |.::|  |::.......|..:
  Fly    63 TQQTAQEDSDFPRFAEPIANV-----TVSVGRDALMACVVENLKGYKVA--WVRVDTQTILSIHH 120

Human   219 SFSPQNNT------------LHIAPVTKEDIGNYSCLVR-NPVSEME---SDIIMPIIYYGPYGL 267
            :...||:.            |||..|.:.|.|.|.|.|. :|:...:   ..::.|||.   .||
  Fly   121 NVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIV---EGL 182

Human   268 QVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYII--KH-----GPRLEVA 325
            ..|.         ..|..|:.|...|.|..:|.....| ||.|....:|  :|     |..|.:.
  Fly   183 TSND---------MVVREGQNISLVCKARGYPEPYVMW-RREDGEEMLIGGEHVNVVDGELLHIT 237

Human   326 SEKVAQKTM-DYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITG--ISLFL-- 385
              ||::..| .|:|.|.|.:              ...:.|.........|:.||..  ...:|  
  Fly   238 --KVSRLHMAAYLCVASNGV--------------PPSISKRVHLRVQFPPMLSIPNQLEGAYLGQ 286

Human   386 -IISMC-------LLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDAL---------DDFG 433
             :|..|       .:..|...:...:|..  ..|...:|....|.||:...:         :|||
  Fly   287 DVILECHTEAYPASINYWTTERGDMIISD--TSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFG 349

Human   434 IYEFVA---FPDVSGVSRIPSRSVPASDCVSGQDLHSTVYE 471
            .|..||   ..:..|..::.....|.:..:|...|.:..|:
  Fly   350 TYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYD 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEPACAM2NP_001275733.1 Ig 128..>197 CDD:299845 12/69 (17%)
I-set 172..255 CDD:254352 21/100 (21%)
IGc2 190..249 CDD:197706 19/73 (26%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 20/98 (20%)
IG_like 82..174 CDD:214653 20/98 (20%)
IG_like 184..267 CDD:214653 23/108 (21%)
IGc2 191..255 CDD:197706 20/66 (30%)
IG_like 282..368 CDD:214653 17/87 (20%)
Ig 288..367 CDD:143165 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.