DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUT7 and FucTA

DIOPT Version :9

Sequence 1:NP_004470.1 Gene:FUT7 / 2529 HGNCID:4018 Length:342 Species:Homo sapiens
Sequence 2:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster


Alignment Length:301 Identity:92/301 - (30%)
Similarity:141/301 - (46%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    64 PSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASM----ESP 124
            |.||        |.|:|||.|.::||.:::....:.|.      .:||.....|  ||    |.|
  Fly   201 PVDT--------CELTANRDLASTADMILYKDHYIPTG------IRRPSNSKQV--SMLYYLECP 249

Human   125 SHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPH------------WGPSPPLPAKSRVAAWVV 177
            .||..:. :....||..:|||||.|..||.:.:.:            :..:     |::..||.|
  Fly   250 YHTQNVK-VPDAINWTATYRRDSTIVAPY
EKWQYYDTKVQQQEQDINYSVN-----KTKKVAWFV 308

Human   178 SNFQERQLRARLYRQLAPHLRVDVFGRANGRPLCA-----SCLVPTVAQYRFYLSFENSQHRDYI 237
            ||...|..|.:...:|..::.||::| |.|...|:     .|.......|:|||:||||..:|||
  Fly   309 SNCGARNGRLQYAHELQKYIEVDIYG-ACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYI 372

Human   238 TEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGM--NESRYQRFFA 300
            ||||:.|||....:|:|:|.....||...|..:::|||:|.|.:|||.:|..:  ::..|..:|.
  Fly   373 TEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFK 437

Human   301 WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQ 341
            |:..... :.|.:..|.||.......|.:.:.|.||..|::
  Fly   438 WKGTGEF-INTYYWCRVCATLHNEEQLRKPRWYTDLNDWWR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FUT7NP_004470.1 Glyco_tran_10_N 44..154 CDD:319100 30/93 (32%)
Glyco_transf_10 169..337 CDD:307136 59/174 (34%)
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 29/92 (32%)
Glyco_transf_10 300..473 CDD:279224 59/174 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4402
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8516
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.