DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and CYTIP

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:89 Identity:23/89 - (25%)
Similarity:36/89 - (40%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   987 QKEVVVPKAKGEILGVVIV------ESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGM 1045
            :|.|.|.|...|..|..|.      ::...|.:.|::..  :...:.|.|..|..||.|..|||:
Human    75 RKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICK--IQEDSPAHCAGLQAGDVLANINGV 137

  Fly  1046 SLVGLPLSTCQSYIRNAKNQTAVK 1069
            |..|.........||::.|...::
Human   138 STEGFTYKQVVDLIRSSGNLLTIE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919
PDZ_signaling 988..1065 CDD:238492 22/82 (27%)
PDZ_signaling 1092..1151 CDD:238492
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 23/86 (27%)
Interaction with CYTH1 166..188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.