DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:262 Identity:64/262 - (24%)
Similarity:92/262 - (35%) Gaps:84/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   879 PNSVVDPSITSPLGDVPTPGIGEEESPPKE-----------PLSKH-NRTPKMICHVFESDEAQF 931
            |.|  |.:.|||    |.||   |..|.:|           ..|.| .|||...||.     |..
Human   109 PQS--DSAPTSP----PIPG---EPGPQREVDKWGGSLGRPESSGHPGRTPATCCHC-----AAV 159

  Fly   932 IAQSIGQAFQVAYMEFLKANGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAK 996
            :|:| |.|...|     :|.|....|..:.:|....|               :||:..:...: |
Human   160 MARS-GSATPPA-----RAPGAPPRSPPQRLDVSGPL---------------RELRPRLCHLR-K 202

  Fly   997 GEILGVVIVESGWGSML------PTVVIANLMSSGAAARCGQLNIGDQLIAINGMSLVGLPLSTC 1055
            |        ..|:|..|      |...|.::.....|||.| |...|:||.:||.::.||..:..
Human   203 G--------PQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG-LRAQDRLIEVNGQNVEGLRHAEV 258

  Fly  1056 QSYIRNAKNQTAV------------KFTVVPCPPVVEVKILRPKALFQLGFSVQNGVICSLLRGG 1108
            .:.|:..:::..:            :..|.|....||..:..|         |.||...:.|.||
Human   259 VASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSP---------VTNGTSPAQLNGG 314

  Fly  1109 IA 1110
            .|
Human   315 SA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919 27/86 (31%)
PDZ_signaling 988..1065 CDD:238492 20/82 (24%)
PDZ_signaling 1092..1151 CDD:238492 7/19 (37%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.