DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_075542.2 Gene:Slc9a3r2 / 65962 MGIID:1890662 Length:337 Species:Mus musculus


Alignment Length:188 Identity:39/188 - (20%)
Similarity:63/188 - (33%) Gaps:72/188 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1025 GAAARCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRNAKNQTAVKFTVV---------------- 1073
            |:.|....|..||:|:.:||:::.|.........|:..:.||  :..||                
Mouse    42 GSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQT--QLLVVDKETDEELCRRQLTCT 104

  Fly  1074 ---------------------PC---------------PPVVEVKILRPKALFQL-------GFS 1095
                                 .|               ||    :.|||: |..|       ||:
Mouse   105 EEMAHRGLPPAHNPWEPKPDWACSGSLGSDTGQKDVNGPP----RELRPR-LCHLRRGPQGYGFN 164

  Fly  1096 VQNG------VICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHDTIVKLLSSSVGE 1147
            :.:.      .|.|:..|..|...|:|...|:||:|.|:|..:.|..:|..:.:...|
Mouse   165 LHSDKSRPGQYIRSVDPGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919
PDZ_signaling 988..1065 CDD:238492 10/39 (26%)
PDZ_signaling 1092..1151 CDD:238492 18/69 (26%)
Slc9a3r2NP_075542.2 PDZ_signaling 9..88 CDD:238492 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..147 3/38 (8%)
PDZ 148..230 CDD:214570 21/76 (28%)
EBP50_C 232..337 CDD:286142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.